DHH Protein, Human

The DHH protein is cleaved into N- and C-product fragments through autoproteolysis and cholesterol transferase activity, where the N-product acquires the cholesterol moiety. In the endoplasmic reticulum, DHH is critical for juxtocrine signaling, endothelial integrity, and Schwann cell-mediated nerve sheath development. DHH Protein, Human (Tag Free) is the recombinant human-derived DHH protein, expressed by E. coli , with tag free. The total length of DHH Protein, Human (Tag Free) is 175 a.a., with molecular weight of ~20 kDa.

The DHH protein precursor exhibits autoproteolysis and cholesterol transferase activity in its C-terminal region, leading to the cleavage of the full-length protein into N-product and C-product fragments, with the addition of a cholesterol moiety to the newly generated N-product. These processes occur in the endoplasmic reticulum. DHH plays a crucial role in cell-cell-mediated juxtacrine signaling and promotes endothelial integrity. It binds to the PTCH1 receptor, in association with SMO, activating the transcription of target genes in endothelial cells. In Schwann cells, DHH controls the development of the peripheral nerve sheath and the transition of mesenchymal cells into the perineurial tube's epithelium-like structure. The lipidated DHH N-product is vital for various developmental patterning events, binding to PTCH1 and activating target gene transcription. DHH is essential for normal testis development, spermatogenesis, and the formation of adult-type Leydig cells, as well as the development of peritubular cells and seminiferous tubules. Additionally, DHH activates primary cilia signaling in neighboring valve interstitial cells through paracrine mechanisms and may induce motor neurons in the lateral neural tube while preventing binding of the DHH protein precursor to PTCH1.

Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 1.729 µg/mL, corresponding to a specific activity is 5.817×10² U/mg.

• 
  Measured by its ability to induce alkaline phosphatase production by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 1.729 µg/mL, corresponding to a specific activity is 5.817×10² U/mg.

Human

E. coli

Tag Free

O43323 (G24-G198)

50846

GPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.