1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DPYS Protein, Human (sf9, His-GST)

The DPYS protein plays a key role in the reductive pyrimidine degradation pathway by catalyzing the second step involving the reversible hydrolysis of dihydropyrimidines. Its enzymatic activity extends to the ring opening of 5,6-dihydrouracil, leading to the formation of N-carbamoyl-alanine, and the conversion of 5,6-dihydrothymine to N-carbamoyl-aminoisobutylene acid ester. DPYS Protein, Human (sf9, His-GST) is the recombinant human-derived DPYS protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The DPYS protein plays a key role in the reductive pyrimidine degradation pathway by catalyzing the second step involving the reversible hydrolysis of dihydropyrimidines. Its enzymatic activity extends to the ring opening of 5,6-dihydrouracil, leading to the formation of N-carbamoyl-alanine, and the conversion of 5,6-dihydrothymine to N-carbamoyl-aminoisobutylene acid ester. DPYS Protein, Human (sf9, His-GST) is the recombinant human-derived DPYS protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.

Background

Dihydropyrimidinase (DPYS) is an enzyme that plays a crucial role in the reductive pyrimidine degradation pathway, catalyzing the reversible hydrolytic ring opening of dihydropyrimidines. Specifically, DPYS can catalyze the ring opening of 5,6-dihydrouracil to N-carbamyl-alanine and 5,6-dihydrothymine to N-carbamyl-amino isobutyrate. This enzymatic activity is a key step in the catabolism of pyrimidine derivatives, contributing to the breakdown of nucleotide and nucleic acid metabolites. The versatility of DPYS in the hydrolytic ring opening of dihydropyrimidines highlights its significance in maintaining pyrimidine homeostasis and the recycling of pyrimidine-related compounds within the cell. Understanding the functions of DPYS provides insights into the regulation of pyrimidine metabolism and its implications for cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-GST;N-His

Accession

Q14117 (M1-P519)

Gene ID
Molecular Construction
N-term
His-GST
DPYS (M1-P519)
Accession # Q14117
C-term
Protein Length

Full Length

Synonyms
Dihydropyrimidinase; DHP; DHPase; Hydantoinase; DPYS
AA Sequence

MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP

Predicted Molecular Mass
84.4 kDa
분자량

Approximately 69 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

DPYS Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

DPYS Protein, Human (sf9, His-GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
DPYS Protein, Human (sf9, His-GST)
Cat. No.:
HY-P75714
수량:
MCE Japan Authorized Agent: