DPYS Protein, Human (sf9, His-GST)
The DPYS protein plays a key role in the reductive pyrimidine degradation pathway by catalyzing the second step involving the reversible hydrolysis of dihydropyrimidines. Its enzymatic activity extends to the ring opening of 5,6-dihydrouracil, leading to the formation of N-carbamoyl-alanine, and the conversion of 5,6-dihydrothymine to N-carbamoyl-aminoisobutylene acid ester. DPYS Protein, Human (sf9, His-GST) is the recombinant human-derived DPYS protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DPYS protein plays a key role in the reductive pyrimidine degradation pathway by catalyzing the second step involving the reversible hydrolysis of dihydropyrimidines. Its enzymatic activity extends to the ring opening of 5,6-dihydrouracil, leading to the formation of N-carbamoyl-alanine, and the conversion of 5,6-dihydrothymine to N-carbamoyl-aminoisobutylene acid ester. DPYS Protein, Human (sf9, His-GST) is the recombinant human-derived DPYS protein, expressed by Sf9 insect cells , with N-GST, N-His labeled tag.
Background
Dihydropyrimidinase (DPYS) is an enzyme that plays a crucial role in the reductive pyrimidine degradation pathway, catalyzing the reversible hydrolytic ring opening of dihydropyrimidines. Specifically, DPYS can catalyze the ring opening of 5,6-dihydrouracil to N-carbamyl-alanine and 5,6-dihydrothymine to N-carbamyl-amino isobutyrate. This enzymatic activity is a key step in the catabolism of pyrimidine derivatives, contributing to the breakdown of nucleotide and nucleic acid metabolites. The versatility of DPYS in the hydrolytic ring opening of dihydropyrimidines highlights its significance in maintaining pyrimidine homeostasis and the recycling of pyrimidine-related compounds within the cell. Understanding the functions of DPYS provides insights into the regulation of pyrimidine metabolism and its implications for cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST;N-His
-
Accession
Q14117 (M1-P519)
-
Molecular Construction
-
N-term
-
His-GST
-
DPYS (M1-P519)
Accession # Q14117 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
DPYS; Dihydropyrimidine Amidohydrolase; Dihydropyrimidinase; Hydantoinase; DHPase; DHP
-
AA Sequence
MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
-
Predicted Molecular Mass
84.4 kDa
-
Molecular Weight
Approximately 69 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
