Copy Link Print Information

DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)
  • DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Tnfrsf21 Protein, also known as death receptor 6 (DR6), CD358, or BM-018, is highly expressed in differentiating neurons as well as in the adult brain, and is upregulated in injured neurons. DR6 negatively regulates neuron, axon, and oligodendrocyte survival, hinders axondendrocyte and oligodendrocyte regeneration and its inhibition has a neuro-protective effect in nerve injury. It activates nuclear factor kappa-B (NFkB) and mitogen-activated protein kinase 8 (MAPK8, also called c-Jun N-terminal kinase 1), and induces cell apoptosis by associating with TNFRSF1A-associated via death domain (TRADD), which is known to mediate signal transduction of tumor necrosis factor receptors. DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-His labeled tag.

Background

Tnfrsf21 Protein promotes apoptosis, possibly via a pathway that involves the activation of NF-kappa-B, and can promote apoptosis mediated by BAX and by the release of cytochrome c from the mitochondria into the cytoplasm. Tnfrsf21 Protein plays a role in neuronal apoptosis, including apoptosis in response to amyloid peptides derived from APP, and is required for both normal cell body death and axonal pruning. Tnfrsf21 Protein also acts as a regulator of pyroptosis: recruits CASP8 in response to reactive oxygen species (ROS) and subsequent oxidation, leading to activation of GSDMC[1][2][3].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED50 for this effect is 368.4 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED50 for this effect is 368.4 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession

    XP_005552846 (Q42-L350)

  • Gene ID
    101925746  [NCBI]
  • Molecular Construction
    • N-term
    • DR6 (Q42-L350)
      Accession # XP_005552846
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF21; BM-018; TNF Receptor Superfamily Member 21; Tumor Necrosis Factor Receptor Superfamily, Member 21; DR6; TNFR-Related Death Receptor 6; Death Receptor 6; Alternative Protein TNFRSF21; CD358; TNFRSF21 Protein; Tumor Necrosis Factor Receptor Superf

  • AA Sequence

    QPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVPSSVMKCKAYTDCLSQNLVVIKPGTKEADNVCGTLPSFSSSTSPSPGTAIFSRPEHMDSHEVPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNHQQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHL

  • Predicted Molecular Mass

    33.5 kDa

  • Molecular Weight

    Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When recombinant human APP770 is coated at 2 μg/mL (100 μL/well) can bind Recombinant Cynomolgus DR6. The ED50 for this effect is 368.4 ng/mL.

  • DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His)
  • DR6/TNFRSF21 Protein, Cynomolgus (HEK293, His) Product Image