E5 Protein, Human papillomavirus type 16 (Cell-Free, His, GST)

E5 protein maintains host cells in a proliferation-competent state by enhancing host epidermal growth factor receptor (EGFR) activation and inhibiting EGFR internalization. It redistributes host caveolin-1 and glycosphingolipid (ganglioside GM1) to the plasma membrane, potentially facilitating immune evasion and cell proliferation. E5 also interacts with vacuolar H+-ATPase, modulating endosomal pH, and disrupts major histocompatibility class I transport, retaining it in the Golgi. Existing as a homooligomer, E5 interacts with host BCAP31, ATP6V0C, and HLA class I, inhibiting the host immune response. E5 Protein, Human papillomavirus type 16 (Cell-Free, His, GST) is the recombinant Virus-derived E5 protein, expressed by E. coli Cell-free, with N-10*His, C-GST labeled tag. The total length of E5 Protein, Human papillomavirus type 16 (Cell-Free, His, GST) is 83 a.a., with molecular weight of 36.4 kDa.

The E5 protein functions to maintain host cells in a proliferation-competent state upon differentiation by enhancing host epidermal growth factor receptor (EGFR) activation and inhibiting EGFR internalization following stimulation by EGF. It induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. Given that GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 potentially facilitates immune evasion and cell proliferation via a shared mechanism. E5 also modulates endosomal pH by interacting with the vacuolar H+-ATPase, a proton pump responsible for acidifying cellular organelles. Additionally, E5 disrupts the transport of major histocompatibility class I to the cell surface, retaining the complex in the Golgi apparatus. Existing as a homooligomer, E5 interacts with host BCAP31, correlating with the ability of HPV-positive differentiated cells to sustain proliferation. Furthermore, E5 engages with host ATP6V0C and HLA class I heavy chains A1, A2, A3, and B8, inhibiting the host immune response by sequestering MHC class I peptides to the host Golgi apparatus.

Virus

E. coli Cell-free

N-10*His;C-GST

P06927 (M1-T83)

1489077

MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT

36.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.