EBAG9 Protein, Human (His)
Based on 1 Customer Validation
EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag.
Background
The EBAG9 Protein emerges as a potential participant in the suppression of cell proliferation and the induction of apoptotic cell death by activating interleukin-1-beta converting enzyme (ICE)-like proteases. Its homodimeric structure suggests a capacity for self-association, underscoring its potential role in intracellular signaling pathways that regulate cell survival and apoptosis. The engagement of EBAG9 in these processes implies a multifaceted function, where it may contribute to the intricate balance between cell growth and programmed cell death.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O00559-1 (R28-S213)
-
Molecular Construction
-
N-term
-
His
-
EBAG9 (R28-S213)
Accession # O00559-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
EBAG9; EB9; Estrogen Receptor Binding Site Associated Antigen 9; Estrogen Receptor-Binding Fragment-Associated Gene 9 Protein; Receptor-Binding Cancer Antigen Expressed On SiSo Cells; Receptor-Binding Cancer Antigen Expressed On SiSo Cells 1; RCAS1; Cance
-
AA Sequence
RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)