EBAG9 Protein, Human (His)

EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag.

The EBAG9 Protein emerges as a potential participant in the suppression of cell proliferation and the induction of apoptotic cell death by activating interleukin-1-beta converting enzyme (ICE)-like proteases. Its homodimeric structure suggests a capacity for self-association, underscoring its potential role in intracellular signaling pathways that regulate cell survival and apoptosis. The engagement of EBAG9 in these processes implies a multifaceted function, where it may contribute to the intricate balance between cell growth and programmed cell death.

Human

E. coli

N-His

O00559-1 (R28-S213)

9166  [NCBI]

Partial

RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Approximately 34 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.