EBAG9 Protein, Human (His)

EBAG9 Protein induces apoptotic cell death and suppresses cell proliferation by activating interleukin-1-beta converting enzyme (ICE)-like proteases. It forms homodimers in its functional processes. EBAG9 Protein, Human (His) is the recombinant human-derived EBAG9 protein, expressed by E. coli , with N-His labeled tag. The total length of EBAG9 Protein, Human (His) is 186 a.a., with molecular weight of ~33 kDa.

The EBAG9 Protein emerges as a potential participant in the suppression of cell proliferation and the induction of apoptotic cell death by activating interleukin-1-beta converting enzyme (ICE)-like proteases. Its homodimeric structure suggests a capacity for self-association, underscoring its potential role in intracellular signaling pathways that regulate cell survival and apoptosis. The engagement of EBAG9 in these processes implies a multifaceted function, where it may contribute to the intricate balance between cell growth and programmed cell death.

Human

E. coli

N-His

O00559-1 (R28-S213)

9166  [NCBI]

RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS

Approximately 31 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.