EDNRA Protein, Human (Cell-Free, His)

EDNRA Protein, a receptor for endothelin-1, activates a phosphatidylinositol-calcium second messenger system through association with G proteins. Its binding affinities follow the order: ET1 > ET2 >> ET3. Additionally, EDNRA interacts with HDAC7 and KAT5. EDNRA Protein, Human (Cell-Free, His) is the recombinant human-derived EDNRA protein, expressed by E. coli Cell-free , with C-10*His labeled tag. The total length of EDNRA Protein, Human (Cell-Free, His) is 407 a.a., with molecular weight of 48.5 kDa.

EDNRA, a pivotal player in cellular signaling, operates as a receptor for endothelin-1, executing its actions through G proteins and initiating a phosphatidylinositol-calcium second messenger system. This receptor exhibits varying binding affinities, with ET1 holding the highest affinity, followed by ET2 and ET3. Beyond its canonical functions in endothelin signaling, EDNRA engages in molecular interactions, forming complexes with HDAC7 and KAT5, potentially contributing to intricate cellular regulatory networks. The convergence of endothelin-1 signaling and protein interactions highlights the multifaceted role of EDNRA in orchestrating diverse cellular processes.

Human

E. coli Cell-free

C-10*His

P25101 (D21-N427)

1909

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

48.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.