EphA7 Protein, Rat (HEK293, His)

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

EphA7 protein is a receptor tyrosine kinase that interacts with GPI-anchored ephrin-A ligands on adjacent cells, initiating bidirectional signaling. This contact-dependent signaling, known as forward signaling, occurs downstream of the receptor, while reverse signaling occurs downstream of the ephrin ligand. Among the ephrin-A ligands, EFNA5 specifically interacts with EphA7, influencing brain development by modulating cell-cell adhesion and repulsion. EphA7 also plays a role in axon guidance, facilitating the proper mapping of corticothalamic and retinal axons. Additionally, EphA7 may contribute to brain development through a proapoptotic activity that depends on caspase (CASP3). Activation of EphA7 can lead to phosphorylation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3.

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED₅₀ for this effect is 212.3 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED₅₀ for this effect is 212.3 ng/mL.

Rat

HEK293

C-His

P54759-1 (Q28-S539)

171287  [NCBI]

Partial

QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAS

Approximately 65-72 kDa.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.