Copy Link Print Information

EphA7 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EphA7 Protein, Rat (HEK293, His)
  • Experimental Validation Results for EphA7 Protein, Rat (HEK293, His)
  • EphA7 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The EphA7 protein is a receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin A ligands (such as EFNA5). It affects brain development by regulating cell-cell adhesion and repulsion. EphA7 Protein, Rat (HEK293, His) is the recombinant rat-derived EphA7 protein, expressed by HEK293 , with C-His labeled tag.

Background

EphA7 protein is a receptor tyrosine kinase that interacts with GPI-anchored ephrin-A ligands on adjacent cells, initiating bidirectional signaling. This contact-dependent signaling, known as forward signaling, occurs downstream of the receptor, while reverse signaling occurs downstream of the ephrin ligand. Among the ephrin-A ligands, EFNA5 specifically interacts with EphA7, influencing brain development by modulating cell-cell adhesion and repulsion. EphA7 also plays a role in axon guidance, facilitating the proper mapping of corticothalamic and retinal axons. Additionally, EphA7 may contribute to brain development through a proapoptotic activity that depends on caspase (CASP3). Activation of EphA7 can lead to phosphorylation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    P54759-1 (Q28-S539)

  • Gene ID
    171287  [NCBI]
  • Molecular Construction
    • N-term
    • EphA7 (Q28-S539)
      Accession # P54759-1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    EPHA7; EK11; EPH Receptor A7; Receptor Protein-Tyrosine Kinase HEK11; Ephrin Type-A Receptor 7; Tyrosine-Protein Kinase Receptor EHK-3; EPH Homology Kinase 3; Receptor Protein-Tyrosine Kinase; Hek11; Alternative Protein EPHA7; EPH-Like Kinase 11; Eph Homo

  • AA Sequence

    QAAKEVLLLDSKAQQTELEWISSPPSGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAVFPDTVTGSEFSSLVEVRGTCVSSAEEEAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRRFYKSSSQDLQCSRCPTHSFSDREGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEAS

  • Molecular Weight

    Approximately 59 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Rat EphA7 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse Ephrin-A4. The ED50 for this effect is 212.3 ng/mL.

  • EphA7 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for EphA7 Protein, Rat (HEK293, His)
  • Experimental Validation Results for EphA7 Protein, Rat (HEK293, His)
  • EphA7 Protein, Rat (HEK293, His) Product Image