2. Recombinant Proteins
  3. CD Antigens Fc Receptors
  4. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  5. Fc gamma RII/CD32 FCGR2A/CD32a
  6. FCGR2A/CD32a
  7. Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His)

Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His)

Cat. No.: HY-P700642
Handling Instructions

Fc gamma RIIA/CD32a Protein plays a pivotal role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Interacting with IgG, it initiates cellular responses against pathogens, crucial for immune modulation. Notably, the protein promotes opsonized antigen phagocytosis, contributing to immune defense. Engaging with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, it participates in intricate signaling pathways, highlighting its multifaceted role in orchestrating diverse immune responses. Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167 mutation. The total length of Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His) is 185 a.a., with molecular weight of 28-34 KDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P70711

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIA/CD32a Protein plays a pivotal role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Interacting with IgG, it initiates cellular responses against pathogens, crucial for immune modulation. Notably, the protein promotes opsonized antigen phagocytosis, contributing to immune defense. Engaging with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, it participates in intricate signaling pathways, highlighting its multifaceted role in orchestrating diverse immune responses. Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167 mutation. The total length of Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His) is 185 a.a., with molecular weight of 28-34 KDa.
Background

The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.
Species

Human
Source

HEK293
Tag

C-6*His
Accession

P12318 (Q34-I218, H167)
Gene ID

2212
Molecular Construction
N-term
CD32a (Q34-I218, H167)
Accession # P12318
6*His
C-term
Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a; CD32; FCGR2A; FCG2; IGFR2
AA Sequence

QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

Molecular Weight

28-34 kDa.
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIA/CD32a Protein, Human (185a.a, HEK293, His)
Cat. No.:
HY-P700642
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.