Copy Link Print Information

Fc gamma RIIA/CD32a Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167, , , , mutation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Fc gamma RIIA/CD32a Protein, Human (HEK293, His)
  • Experimental Validation Results for Fc gamma RIIA/CD32a Protein, Human (HEK293, His)
  • Fc gamma RIIA/CD32a Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167, , , , mutation.

Background

The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.

Verified Bioactivity

1. Loaded Human CD32a His on HIS1K Biosensor, can bind Anti-Human HER2 mAb with an affinity constant of 0.98 uM as determined in BLI assay.
2. Immobilized  Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1  protein. The ED50 for this effect is 3.612 μg/mL, corresponding to a specific  activity is 2.77×102 Unit/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P12318-1 (A36-I218, H167)

  • Gene ID
    2212  [NCBI]
  • Molecular Construction
    • N-term
    • CD32a (A36-I218, H167)
      Accession # P12318-1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FCGR2A; Fc Fragment Of IgG, Low Affinity IIa, Receptor (CD32); Prev. FCGR2A1; Fc Fragment Of IgG Receptor IIa; Prev. FCG2; IgG Fc Receptor II-A; Prev. FCGR2; FcRII-A; Fc-Gamma-RIIa; Fc Fragment Of IgG, Low Affinity IIa, Receptor For (CD32); IGFR2; Fc Gamm

  • AA Sequence

    AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

  • Molecular Weight

    Approximately 25-32 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 3.612 μg/mL, corresponding to a specific activity is 2.77×102 Unit/mg.

  • Fc gamma RIIA/CD32a Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Fc gamma RIIA/CD32a Protein, Human (HEK293, His)
  • Experimental Validation Results for Fc gamma RIIA/CD32a Protein, Human (HEK293, His)
  • Fc gamma RIIA/CD32a Protein, Human (HEK293, His) Product Image