FGF-19 Protein, Human (HEK293, Flag)

Customer Review

Based on 1 Customer Validation

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FGF-19 Protein, Human could activate a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism.

Background

Fibroblast growth factor 19 (FGF19, also called FGF15 in rodents) is a member of a subfamily of fibroblast growth factors that govern nutrient metabolism. FGF19 binds to a receptor complex composed of the FGF receptor 4 (FGFR4) and a coreceptor called β-Klotho, which are both highly expressed in liver. FGF19 is an enterokine synthesized and released when bile acids are taken up into the ileum. FGF19 stimulates hepatic protein and glycogen synthesis but does not induce lipogenesis. FGF19 activates a physiologically important, insulin-independent endocrine pathway that regulates hepatic protein and glycogen metabolism[1].

Verified Bioactivity

Measured in a cell proliferation assay using murine Balb/c 3T3 cells. The ED50 is <150 ng/mL, corresponding to a specific activity is >6.7×103 IU/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-Flag
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Flag
    • FGF-19 (R25-K216)
      Accession # O95750
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF19; Fibroblast Growth Factor; Fibroblast Growth Factor 19; FGF; FGF-19

  • AA Sequence

    LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

  • Predicted Molecular Mass

    27.5 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00