1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Enzymes & Regulators
  3. FGF Family Stem Cell CD Proteins Epithelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. FGFR-3/CD333 FGFR
  5. FGFR-3
  6. FGFR-3 Protein, Mouse (HEK293, His-Fc)

FGFR-3 Protein, Mouse (HEK293, His-Fc)

Cat. No.: HY-P73056
Handling Instructions

The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293, with C-hFc, C-His labeled tag. The total length of FGFR-3 Protein, Mouse (HEK293, His-Fc) is 367 a.a., with molecular weight of 100-110 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FGFR-3 Protein is a member of the fibroblast growth factor receptor family. FGFR-3 Protein regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived FGFR-3 protein, expressed by HEK293, with C-hFc, C-His labeled tag. The total length of FGFR-3 Protein, Mouse (HEK293, His-Fc) is 367 a.a., with molecular weight of 100-110 kDa.

Background

FGFR-3 is a member of the fibroblast growth factor receptor family and is expressed in tissues such as cartilage, brain, intestine, and kidney. The FGFR-3 protein plays a role in bone growth by regulating ossification. FGFR-3 is an important regulator of intrachondral and membranous ossification, acting as a negative regulator of long bone growth. FGFR-3 mutations are also associated with sperm cell tumors. FGFR-3 regulates chondrocyte differentiation and chondrocyte proliferation by activating the MAPK/STAT signaling pathway[1][2][3][4][5][6].

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

Q7TSI8 (M1-Y367)

Gene ID
Molecular Construction
N-term
FGFR-3 (M1-Y367)
Accession # Q7TSI8
hFc-His
C-term
Synonyms
Fibroblast growth factor receptor 3; FGFR-3; CD333; JTK4
AA Sequence

MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCHPPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFSVRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMETDEAGSVY

Molecular Weight

100-110 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGFR-3 Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P73056
Quantity:
MCE Japan Authorized Agent: