FGL1 Protein, Cynomolgus (HEK293, mFc)

FGL1 Protein, a potent immune suppressive molecule, inhibits antigen-specific T-cell activation as a major ligand for LAG3. It crucially contributes to LAG3-mediated T-cell inhibitory functions, independently of MHC class II. Secreted by hepatocytes, FGL1 also promotes their growth. The homodimeric form of the protein interacts with LAG3, specifically engaging with its Ig-like domains 1 and 2 through the Fibrinogen C-terminal domain. FGL1 Protein, Cynomolgus (HEK293, mFc) is the recombinant cynomolgus-derived FGL1 protein, expressed by HEK293 , with N-mFc labeled tag.

FGL1 Protein serves as a potent immune suppressive molecule, exerting its inhibitory effect on antigen-specific T-cell activation as a major ligand for LAG3. It is a crucial contributor to LAG3-mediated T-cell inhibitory functions, and notably, its binding to LAG3 occurs independently of MHC class II. Additionally, FGL1 is secreted by hepatocytes and plays a role in promoting their growth. The protein exists in a homodimeric form and interacts with LAG3 through its Fibrinogen C-terminal domain, specifically engaging with the Ig-like domains 1 and 2 of LAG3.

Immobilized Biotinylated Human LAG-3 Fc-Avi at 1 μg/mL (100 μL/well) on Streptavidin precoated (0.5 μg/well) plate can bind Cynomolgus / Rhesus macaque FGL1 mFc with a linear range of 0.019-0.625 μg/mL.

• 
  Immobilized Mouse LAG-3, His Tag at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED₅₀ for this effect is 0.5343 μg/mL.

Cynomolgus

HEK293

N-mFc

G7N0K6 (L23-I312)

102118020

Full Length of Mature Protein

LEDCAQEQVRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGEENSVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFAVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGSFHPEVQWWATHQRMKFSTWDRDHDNYDGNCAEEDQSGWWFNRCHSANLNGLYYTGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

60-66 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/rd-cell.html