Fibrillin-1/Asprosin Protein, Human (HEK293, N-His)

Fibrillin-1, or asprosin, is an important structural component of 10-12 nm microfibers in the extracellular matrix, which provides support to connective tissues such as lungs, blood vessels and skin. It forms a network independent of elastin in certain tissues, helping to increase tensile strength. Fibrillin-1/Asprosin Protein, Human (HEK293, N-His) is the recombinant human-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-6*His labeled tag. The total length of Fibrillin-1/Asprosin Protein, Human (HEK293, N-His) is 140 a.a., with molecular weight of 26-33 kDa.

Fibrillin-1, known as asprosin, serves as a vital structural component of the 10-12 nm diameter microfibrils within the extracellular matrix, conferring both structural support and regulatory functions to load-bearing connective tissues. These microfibrils contribute to long-term force-bearing structural support in various tissues, such as the lung, blood vessels, and skin, where they form the periphery of elastic fibers. Fibrillin-1-containing microfibrils act as scaffolds for elastin deposition, and in specific tissues like the ciliary zonule, tendon, cornea, and glomerulus, they form elastin-independent networks, providing tensile strength and anchoring roles. Beyond its structural role, Fibrillin-1 plays a crucial role in tissue homeostasis through specific interactions with growth factors, including bone morphogenetic proteins (BMPs), growth and differentiation factors (GDFs), and latent transforming growth factor-beta-binding proteins (LTBPs), as well as with cell-surface integrins and other extracellular matrix components. It regulates osteoblast maturation, negatively influences osteoclastogenesis by sequestering TNFSF11, and mediates cell adhesion through interactions with integrins. As an adipokine secreted by white adipose tissue, asprosin regulates glucose metabolism in the liver, muscle, and pancreas, exerting effects on plasma glucose levels in response to fasting. Additionally, asprosin functions as an orexigenic hormone, crossing the blood-brain barrier to stimulate appetite by activating orexigenic AgRP neurons and inhibiting anorexigenic POMC neurons in the hypothalamus. It may also play a role in sperm motility in the testis via interaction with the OR4M1 receptor.

Human

HEK293

N-6*His

P35555 (S2732-H2871)

2200

STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

26-33 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.