Copy Link Print Information

Fibrillin-1/Asprosin Protein, Human (HEK293, His)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

Fibrillin-1 and Asprosin are two proteins generated from the same precursor protein, which is encoded by the Fibrillin 1 gene, through proteolytic cleavage. Fibrillin-1 protein, a member of the fibrillin family, is a crucial structural protein in the formation of microfibrils in the extracellular matrix, maintaining tissue homeostasis and cell adhesion, regulating the availability of growth factors, and inhibiting osteoclastogenesis. In contrast, Asprosin is a hormone primarily secreted by white adipose tissue and is involved in regulating glucose metabolism within the body. Fibrillin-1/Asprosin protein, Human (HEK293, His) is a recombinant protein expressed in HEK293 cells with an N-terminal His tag, comprising a full length of 140 amino acids (S2732-H2871).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Fibrillin-1/Asprosin Protein, Human (HEK293, His)
  • Experimental Validation Results for Fibrillin-1/Asprosin Protein, Human (HEK293, His)
  • Fibrillin-1/Asprosin Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fibrillin-1 and Asprosin are two proteins generated from the same precursor protein, which is encoded by the Fibrillin 1 gene, through proteolytic cleavage. Fibrillin-1 protein, a member of the fibrillin family, is a crucial structural protein in the formation of microfibrils in the extracellular matrix, maintaining tissue homeostasis and cell adhesion, regulating the availability of growth factors, and inhibiting osteoclastogenesis. In contrast, Asprosin is a hormone primarily secreted by white adipose tissue and is involved in regulating glucose metabolism within the body. Fibrillin-1/Asprosin protein, Human (HEK293, His) is a recombinant protein expressed in HEK293 cells with an N-terminal His tag, comprising a full length of 140 amino acids (S2732-H2871)[1][2][3][4][5][6][7][8][9][10][11].

Background

Fibrillin-1 is a key structural protein in the formation of extracellular matrix microfibrils. It plays a critical role in maintaining the structural integrity and functional stability of connective tissues, not only providing physical support but also participating in the regulation of tissue homeostasis and bone metabolism through interactions with various growth factors, integrins, and heparin.
1. Physical Structural Support:
(1) In tissues such as the lung, blood vessels, and skin, Fibrillin-1 supports the formation of elastic fibers[1].
(2) In tissues lacking elastin, such as the ciliary zonule, tendon, cornea, and glomerulus, Fibrillin-1 provides structural support[1].
2. Homeostasis Regulation and Metabolic Control:
(1) Fibrillin-1 maintains tissue structural stability through specific interactions with growth factors (such as bone morphogenetic proteins (BMPs), growth and differentiation factors (GDFs), latent transforming growth factor beta-binding proteins (LTBPs)), cell surface integrins, and other extracellular matrix proteins and proteoglycan components[1].
(2) Fibrillin-1 inhibits osteoclastogenesis by binding to the osteoclast differentiation factor TNFSF11 and suppressing the TNFSF11-mediated nuclear translocation and activation of the transcription factor NFATC1, thereby influencing bone metabolism[2].
Fibrillin-1 mediates cell adhesion by binding to cell surface receptors integrins ITGAV and ITGA5[3][4]. It can also bind heparin, ensuring the proper assembly of microfibrils[5].
Asprosin is a hormone secreted by white adipose tissue that plays a crucial role in regulating energy balance in the body, particularly in maintaining blood glucose levels during fasting. Asprosin acts on the liver during fasting by binding to the olfactory receptor OR4M1 on hepatocytes, activating protein kinase A (PKA), and triggering the rapid release of glucose into the bloodstream. Asprosin also promotes rapid glucose release by activating the G protein-cAMP-PKA pathway[6][7][8][9].

In Vitro

Fibrillin-1 protein (Human) (0-20 μg/mL, 48 h) promotes αvβ3 and α5β1 integrin-mediated adhesion of human umbilical vein endothelial cells in a dose-dependent manner and enhances their proliferation and migration at a dose of 1 μg/mL[10].

In Vivo

Asprosin protein (human) (2 mg/kg, i.p., single dose, with blood samples collected 48 hours or 7 days after administration) has a cardioprotective effect in Isoprenaline hydrochloride (HY-B0468)-induced myocardial infarction rat models[11].

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized Human MFAP4 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human Fibrillin-1. The ED50 for this effect is ≤0.8473 μg/mL, corresponding to a specific activity is ≥1.18×103 Unit/mg.
2.Measured by its ability to induce TNF-ɑ secretion by macrophages produced by THP-1 cells treated with dihydroxyvitamin D3.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His
  • Accession

    P35555 (S2732-H2871)

  • Gene ID
    2200  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His
    • Asprosin (S2732-H2871)
      Accession # P35555
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FBN1; Epididymis Secretory Sperm Binding Protein; Prev. FBN; Alternative Protein FBN1; Prev. MFS1; Marfan Syndrome; Prev. WMS; Fibrillin 15; Fibrillin-1; GPHYSD2; MASS; ACMICD; OCTD; ECTOL1; SGS; MFLS; Fibrillin-1 Preproprotein; SSKS; Asprosin; WMS2; Fibr

  • AA Sequence

    STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jensen SA, et al. New insights into the structure, assembly and biological roles of 10-12 nm connective tissue microfibrils from fibrillin-1 studies. Biochem J. 2016 Apr 1;473(7):827-38. [Content Brief]

[2]. Tiedemann K, et al. Fibrillin-1 directly regulates osteoclast formation and function by a dual mechanism. J Cell Sci. 2013 Sep 15;126(Pt 18):4187-94. [Content Brief]

[3]. Bax DV, et al. Cell adhesion to fibrillin-1 molecules and microfibrils is mediated by alpha 5 beta 1 and alpha v beta 3 integrins. J Biol Chem. 2003 Sep 5;278(36):34605-16. [Content Brief]

[4]. Jovanovic J, et al. alphaVbeta6 is a novel receptor for human fibrillin-1. Comparative studies of molecular determinants underlying integrin-rgd affinity and specificity. J Biol Chem. 2007 Mar 2;282(9):6743-51. [Content Brief]

[5]. Tiedemann K, et al. Interactions of fibrillin-1 with heparin/heparan sulfate, implications for microfibrillar assembly. J Biol Chem. 2001 Sep 21;276(38):36035-42. [Content Brief]

[6]. Romere C, et al. Asprosin, a Fasting-Induced Glucogenic Protein Hormone. Cell. 2016 Apr 21;165(3):566-79. [Content Brief]

[7]. Lee T, et al. Asprosin impairs insulin secretion in response to glucose and viability through TLR4/JNK-mediated inflammation. Mol Cell Endocrinol. 2019 Apr 15;486:96-104. [Content Brief]

[8]. Li E, et al. OLFR734 Mediates Glucose Metabolism as a Receptor of Asprosin. Cell Metab. 2019 Aug 6;30(2):319-328.e8. [Content Brief]

[9]. Li E, et al. OLFR734 Mediates Glucose Metabolism as a Receptor of Asprosin. Cell Metab. 2019 Aug 6;30(2):319-328.e8. [Content Brief]

[10]. Mariko B, et al. Microfibrils and fibrillin-1 induce integrin-mediated signaling, proliferation and migration in human endothelial cells. Am J Physiol Cell Physiol. 2010 Nov;299(5):C977-87. [Content Brief]

[11]. Onat E, et al. The protective effects of humanin in rats with experimental myocardial infarction: The role of asprosin and spexin. Heliyon. 2023 Jul 26;9(8):e18739. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human MFAP4 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human Fibrillin-1. The ED50 for this effect is 0.6163 μg/mL, corresponding to a specific activity is 1.62×103 Unit/mg.

  • Fibrillin-1/Asprosin Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Fibrillin-1/Asprosin Protein, Human (HEK293, His)
  • Experimental Validation Results for Fibrillin-1/Asprosin Protein, Human (HEK293, His)
  • Fibrillin-1/Asprosin Protein, Human (HEK293, His) Product Image