Fibrillin-1/Asprosin Protein, Human (HEK293, His)

Asprosin Protein, Human (HEK293, His), a recombinant human Asprosin produced in HEK293 cells, with a His tag. Asprosin is a fasting-induced glucogenic protein hormone^[1].

Asprosin is secreted by white adipose, circulates at nanomolar levels, and is recruited to the liver, where it activates the G protein-cAMP-PKA pathway, resulting in rapid glucose release into the circulation. Humans and mice with insulin resistance show pathologically elevated plasma Asprosin, and its loss of function via immunologic or genetic means has a profound glucose- and insulin-lowering effect secondary to reduced hepatic glucose release. Asprosin represents a glucogenic protein hormone, and therapeutically targeting it may be beneficial in type II diabetes and metabolic syndrome^[1].

Measured by its binding ability in a functional ELISA. Immobilized Human MFAP4 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human Fibrillin-1. The ED₅₀ for this effect is ≤0.8473 μg/mL, corresponding to a specific activity is ≥1.18×10³ Unit/mg.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human MFAP4 at 0.5 μg/mL (100 μL/well) can bind Biotinylated Human Fibrillin-1. The ED₅₀ for this effect is 0.6163 μg/mL, corresponding to a specific activity is 1.62×10³ Unit/mg.

Human

HEK293

N-8*His

P35555 (S2732-H2871)

2200  [NCBI]

STNETDASNIEDQSETEANVSLASWDVEKTAIFAFNISHVSNKVRILELLPALTTLTNHNRYLIESGNEDGFFKINQKEGISYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDKYDKDYLSGELGDNLKMKIQVLLH

26-33 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chase Romere, et al. Asprosin, a Fasting-Induced Glucogenic Protein Hormone. Cell.2016 Apr 21;165(3):566-79.  [Content Brief]