2. Recombinant Proteins
  3. Others
  4. Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His)

Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His)

Cat. No.: HY-P7811A
Handling Instructions

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag. The total length of Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His) is 140 a.a., with molecular weight of ~27.71 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

*

This product has been "discontinued". Optimized version of product available: HY-P7811

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag. The total length of Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His) is 140 a.a., with molecular weight of ~27.71 kDa.
Background

The oglycan components are involved in various biological processes. They regulate osteoblast maturation by controlling the availability of TGF-beta and calibrating TGF-beta and BMP levels. They also negatively regulate osteoclastogenesis by binding and sequestering TNFSF11, a factor important for osteoclast differentiation and function. This disrupts TNFSF11-induced signaling and impairs the activation of transcription factor NFATC1, which is important for osteoclast differentiation.
Species

Mouse
Source

HEK293
Tag

N-His
Accession

Q61554 (S2734-H2873)
Gene ID

14118  [NCBI]
Molecular Construction
N-term
His
Asprosin (S2734-H2873)
Accession # Q61554
C-term
Synonyms
rMuFibrillin-1/Asprosin, His; Fibrillin-1; Fbn1; Asprosin; Fbn-1
AA Sequence

STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Molecular Weight

Approximately 27.71 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fibrillin-1/Asprosin Protein, Mouse (HEK293, N-His)
Cat. No.:
HY-P7811A
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.