Fibrillin-1/Asprosin Protein, Mouse (HEK293, His)

Fibrillin-1/Asprosin proteins play crucial roles in a variety of biological processes. They regulate osteoblast maturation by controlling the availability of TGF-β and regulating TGF-β and BMP levels. Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fibrillin-1/Asprosin protein, expressed by HEK293 , with N-His labeled tag. The total length of Fibrillin-1/Asprosin Protein, Mouse (HEK293, His) is 138 a.a., with molecular weight of ~30.0 kDa.

The oglycan components are involved in various biological processes. They regulate osteoblast maturation by controlling the availability of TGF-beta and calibrating TGF-beta and BMP levels. They also negatively regulate osteoclastogenesis by binding and sequestering TNFSF11, a factor important for osteoclast differentiation and function. This disrupts TNFSF11-induced signaling and impairs the activation of transcription factor NFATC1, which is important for osteoclast differentiation.

Measured in a cell proliferation assay using human umbilical vein endothelial cells. The ED₅₀ this effect is 20.33 ng/mL, corresponding to a specific activity is 4.919×10⁴ units/mg.

Mouse

HEK293

N-His

Q61554 (S2734-H2873)

14118  [NCBI]

STNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVNNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKKPVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH

Approximately 30.0 kDa

Greater than 85% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.