Ficolin-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Ficolin-1, encoded by FCN1, is primarily expressed in peripheral blood leukocytes and is proposed to function as a plasma protein with elastin-binding activity. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ficolin-1, encoded by FCN1, is primarily expressed in peripheral blood leukocytes and is proposed to function as a plasma protein with elastin-binding activity. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Ficolin-1 Protein, a member of the ficolin family, is distinguished by the presence of a leader peptide, a short N-terminal segment, a collagen-like region, and a C-terminal fibrinogen-like domain. These structural elements are shared with other proteins such as complement protein C1q, collectins, and tenascins, but each protein within this group recognizes distinct targets and serves unique functions. Ficolin-1, encoded by FCN1, is primarily expressed in peripheral blood leukocytes and is proposed to function as a plasma protein with elastin-binding activity. Notably, Ficolin-1 demonstrates biased expression, with elevated levels observed in the bone marrow (RPKM 318.5), appendix (RPKM 117.5), and three other tissues, suggesting its potential significance in various physiological contexts across multiple tissues.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED50 for this effect is 1.49 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
NP_001994.2 (A30-A326)
-
Molecular Construction
-
N-term
-
Ficolin-1 (A30-A326)
Accession # NP_001994.2 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FCN1; M-Ficolin; Ficolin 1; Ficolin-A; FCNM; Ficolin (Collagen/Fibrinogen Domain Containing) 1; Ficolin (Collagen/Fibrinogen Domain-Containing) 1; Collagen/Fibrinogen Domain-Containing Protein 1; Ficolin-Alpha; P35-Related Protein; Ficolin-1
-
AA Sequence
ADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
-
Molecular Weight
Approximately 34-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 350 mM NaCl, 200 mM L-Arginine, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
