Ficolin-1 Protein, Human (HEK293, His)

IFN-β protein is a recombinant protein that does not use any animal-derived components in its production. It is used in biomedical research and drug manufacturing as a therapeutic agent for a variety of diseases, including multiple sclerosis. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ficolin-1 Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 33-38 kDa.

The Ficolin-1 Protein, a member of the ficolin family, is distinguished by the presence of a leader peptide, a short N-terminal segment, a collagen-like region, and a C-terminal fibrinogen-like domain. These structural elements are shared with other proteins such as complement protein C1q, collectins, and tenascins, but each protein within this group recognizes distinct targets and serves unique functions. Ficolin-1, encoded by FCN1, is primarily expressed in peripheral blood leukocytes and is proposed to function as a plasma protein with elastin-binding activity. Notably, Ficolin-1 demonstrates biased expression, with elevated levels observed in the bone marrow (RPKM 318.5), appendix (RPKM 117.5), and three other tissues, suggesting its potential significance in various physiological contexts across multiple tissues.

Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED₅₀ for this effect is 1.49 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED₅₀ for this effect is 1.49 μg/mL.

Human

HEK293

C-His

NP_001994.2 (A30-A326)

2219  [NCBI]

ADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA

33-38 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, 350 mM NaCl, 200 mM Arginine , pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.