1. Recombinant Proteins
  2. Others
  3. Ficolin-1 Protein, Human (HEK293, His)

Ficolin-1 Protein, Human (HEK293, His)

Cat. No.: HY-P76930
COA Handling Instructions

IFN-β protein is a recombinant protein that does not use any animal-derived components in its production. It is used in biomedical research and drug manufacturing as a therapeutic agent for a variety of diseases, including multiple sclerosis. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ficolin-1 Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 33-38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $70 In-stock
50 μg $185 In-stock
100 μg $295 In-stock
500 μg $770 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-β protein is a recombinant protein that does not use any animal-derived components in its production. It is used in biomedical research and drug manufacturing as a therapeutic agent for a variety of diseases, including multiple sclerosis. Ficolin-1 Protein, Human (HEK293, His) is the recombinant human-derived Ficolin-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of Ficolin-1 Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 33-38 kDa.

Background

The Ficolin-1 Protein, a member of the ficolin family, is distinguished by the presence of a leader peptide, a short N-terminal segment, a collagen-like region, and a C-terminal fibrinogen-like domain. These structural elements are shared with other proteins such as complement protein C1q, collectins, and tenascins, but each protein within this group recognizes distinct targets and serves unique functions. Ficolin-1, encoded by FCN1, is primarily expressed in peripheral blood leukocytes and is proposed to function as a plasma protein with elastin-binding activity. Notably, Ficolin-1 demonstrates biased expression, with elevated levels observed in the bone marrow (RPKM 318.5), appendix (RPKM 117.5), and three other tissues, suggesting its potential significance in various physiological contexts across multiple tissues.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED50 for this effect is 1.49 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Fetuin at 10 μg/mL (100 μL/well) can bind Human Ficolin-1. The ED50 for this effect is 1.49 μg/mL.
Species

Human

Source

HEK293

Tag

C-His

Accession

NP_001994.2 (A30-A326)

Gene ID
Molecular Construction
N-term
Ficolin-1 (A30-A326)
Accession # NP_001994.2
His
C-term
Synonyms
Ficolin-1; Collagen/fibrinogen domain-containing protein 1; Ficolin-A; FCNM
AA Sequence

ADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA

Molecular Weight

33-38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, 350 mM NaCl, 200 mM Arginine , pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ficolin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ficolin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P76930
Quantity:
MCE Japan Authorized Agent: