GADD45A/DDIT-1 Protein, Human (His)
GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
In T-cells, the GADD45A/DDIT-1 protein functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity, demonstrating its role in modulating cellular signaling pathways. Additionally, GADD45A/DDIT-1 might influence the interaction between PCNA and certain CDK complexes, thereby stimulating DNA excision repair in vitro while inhibiting the entry of cells into the S phase of the cell cycle. The protein interacts with MAPK14, and its quaternary structure exhibits a dynamic range, predominantly existing as a monomer while forming dimers and other oligomers with increasing concentration. GADD45A/DDIT-1 engages in specific protein-protein interactions, including weak interaction with PCNA and interaction with GADD45GIP1. Furthermore, it interacts with AURKA, suggesting a potential role in competing with dimerization processes related to cell cycle regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P24522 (M1-R165)
-
Molecular Construction
-
N-term
-
6*His
-
GADD45A (M1-R165)
Accession # P24522 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GADD45A; Growth Arrest And DNA-Damage-Inducible 45 Alpha; Prev. DDIT1; DDIT-1; GADD45; Growth Arrest And DNA-Damage-Inducible, Alpha; Growth Arrest And DNA Damage-Inducible Protein GADD45 Alpha; DNA Damage-Inducible Transcript-1; Growth Arrest And DNA Dam
-
AA Sequence
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
-
Predicted Molecular Mass
20.5 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
