GADD45A/DDIT-1 Protein, Human (His)

GADD45A/DDIT-1 protein regulates p38 MAPK by inhibiting p88 phosphorylation in T cells, thereby affecting cell signaling pathways. It can regulate the PCNA-CDK complex, promote DNA excision repair, and hinder S phase entry. GADD45A/DDIT-1 Protein, Human (His) is the recombinant human-derived GADD45A/DDIT-1 protein, expressed by E. coli , with N-6*His labeled tag.

In T-cells, the GADD45A/DDIT-1 protein functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity, demonstrating its role in modulating cellular signaling pathways. Additionally, GADD45A/DDIT-1 might influence the interaction between PCNA and certain CDK complexes, thereby stimulating DNA excision repair in vitro while inhibiting the entry of cells into the S phase of the cell cycle. The protein interacts with MAPK14, and its quaternary structure exhibits a dynamic range, predominantly existing as a monomer while forming dimers and other oligomers with increasing concentration. GADD45A/DDIT-1 engages in specific protein-protein interactions, including weak interaction with PCNA and interaction with GADD45GIP1. Furthermore, it interacts with AURKA, suggesting a potential role in competing with dimerization processes related to cell cycle regulation.

Human

E. coli

N-6*His

P24522 (M1-R165)

1647  [NCBI]

Full Length

MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Approximately 18 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.