GDI2 Protein, Human (P.pastoris, His)
GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GDI2 protein inhibits the exchange of GDP to GTP in Rab proteins and regulates intracellular membrane transport. GDI2 Protein, Human (P.pastoris, His) is the recombinant human-derived GDI2 protein, expressed by P. pastoris , with N-His labeled tag.
Background
The GDI2 Protein acts as a GDP-dissociation inhibitor, preventing the exchange of GDP to GTP for most Rab proteins and thereby regulating intracellular membrane trafficking. By maintaining these small GTPases in their inactive GDP-bound form, GDI2 plays a crucial role in modulating cellular processes. It serves as a negative regulator of protein transport to the cilium and ciliogenesis by inhibiting RAB8A. GDI2 interacts with RHOH and the GDP-bound forms of various Rab proteins, including RAB3A, RAB3B, RAB3C, RAB5A, RAB5B, RAB5C, RAB8B, RAB10, RAB12, RAB35, and RAB43, with a lesser extent of binding to RAB3D. Furthermore, it interacts specifically with the GDP-bound inactive form of RAB8A, preventing its activation. The protein also interacts with DZIP1, negatively regulating the interaction between GDI2 and GDP-bound RAB8A. These interactions highlight the intricate regulatory role of GDI2 in governing membrane trafficking and cellular transport processes.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
P50395 (M1-D445)
-
Molecular Construction
-
N-term
-
His
-
GDI2 (M1-D445)
Accession # P50395 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GDI2; HEL-S-46e; GDP Dissociation Inhibitor 2; GDI-2; RABGDIB; Epididymis Secretory Sperm Binding Protein Li 46e; Guanosine Diphosphate Dissociation Inhibitor 2; Rab GDP-Dissociation Inhibitor, Beta; Rab GDP Dissociation Inhibitor Beta; Rab GDP Dissociati
-
AA Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
-
Predicted Molecular Mass
52.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
