1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Glial Cell Line-derived Neurotrophic Factor (GDNF)
  6. GDNF Protein, Mouse (CHO)

Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons. GDNF Protein, Mouse (CHO) is produced in CHO cells, and consists of 134 amino acids (S78-I211).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
In Vivo Efficacy Study
Histological Imaging/Staining
RT-PCR

    GDNF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Sep 21:130:106118.  [Abstract]

    Macroscopic appearance and length of the GDNF Protein, Mouse (CHO) (GDNF, 100 μg/kg; i.p.; once every other day for 6 times starting from the 26th day of restraint stress)-treated mice colon (n = 3 per group). Abbreviations: DSS, dextran sulfate sodium.

    GDNF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Sep 21:130:106118.  [Abstract]

    HE staining and pathological scoring of sections in the GDNF Protein, Mouse (CHO) (GDNF, 100 μg/kg; i.p.; once every other day for 6 times starting from the 26th day of restraint stress)-treated mice distal colon (red arrows delineate the shedding of colonic epithelial cells; green arrows delineate inflammatory cell infiltration; and the black rectangular box highlights the loss of colonic crypts) (n = 3 per group, Scale bar = 200 μm). Abbreviations: DSS, dextran sulfate sodium.

    GDNF Protein, Mouse (CHO) purchased from MCE. Usage Cited in: Brain Behav Immun. 2025 Sep 21:130:106118.  [Abstract]

    Protein expression levels of IL-22 in the GDNF Protein, Mouse (CHO) (GDNF, 100 μg/kg; i.p.; once every other day for 6 times starting from the 26th day of restraint stress)-treated mice colon (n = 9 per group). Abbreviations: DSS, dextran sulfate sodium.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Glial-cell-line-derived neurotrophic factor (GDNF), a neurotrophic factor belongs to the GDNF family ligands (GFLs)., promotes survival of dopamine neurons. GDNF demonstrates a variety of neuroprotective roles for mammalian neurons[1]. GDNF Protein, Mouse (CHO) is produced in CHO cells, and consists of 134 amino acids (S78-I211).

    Background

    Glial cell line-derived neurotrophic factor (GDNF) is a 134 amino acid protein belonging in the GDNF family ligands (GFLs). GDNF protein is widely distributed throughout both the central and peripheral nervous systems. Synthesis and secretion of GDNF occur in many cell types such as glial cells like astrocytes, oligodendrocytes, and Schwann cells; motor neurons (MNs); and skeletal muscle[1].
    Mature human GDNF shares 91-92% amino acid sequence identity with mouse, rat, and Canine GDNF proteins. While, mouse GDNF shares 99% aa sequence identity with rat GDNF protein.
    GDNF is originally isolated from cultured B49 rat glial cells and found to enhance the survival and differentiation of dopaminergic neurons in primary cultures by promoting dopamine uptake. Similar to other members of the TGF-β superfamily, GDNF is first synthesized as a precursor protein (pro-GDNF). After a series of protein cleavage and processing, the 211 amino acid pro-GDNF is finally converted into the active and mature form of GDNF. GDNF has the ability to trigger receptor tyrosine kinase RET phosphorylation, whose downstream effects have been found to promote neuronal health and survival. The binding of GDNF to its receptors triggers several intracellular signaling pathways which play roles in promoting the development, survival, and maintenance of neuron-neuron and neuron-target tissue interactions. The synthesis and regulation of GDNF have been shown to be altered in many diseases, aging, exercise, and addiction. The neuroprotective effects of GDNF may be used to develop treatments and therapies to ameliorate neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS)[1].
    GDNF is a potent neurotrophic factor for regulating MN survival in the peripheral nervous system. GDNF prevents apoptosis of MNs during development in vivo, decreases the loss of MNs in animal models of motor neuropathy and degeneration, rescues MNs from axotomy-induced cell death, and protects MNs from chronic degeneration. Intracerebral GDNF administration exerts both protective and reparative effects on the nigrostriatal dopamine system, which may have implications for the development of new treatment strategies for Parkinson's disease[1][2].

    In Vitro

    Recombinant rat GDNF (10 ng/mL) maintains proliferation and self-renewal of mouse spermatogonial stem cells[3].

    In Vivo

    In a mouse Parkinson's disease model, recombinant mouse GDNF (10 μg/2 μL) injected over the substantia nigra or in striatum before MPTP potently protects the dopamine system, as shown by numbers of mesencephalic dopamine nerve cell bodies, dopamine nerve terminal densities and dopamine levels. When GDNF is given after MPTP, dopamine levels and fibre densities are significantly restored[1].

    Biological Activity

    The ED50 is <8 µg/mL as measured by C6 cells.

    Species

    Mouse

    Source

    CHO

    Tag

    Tag Free

    Accession

    P48540 (S78-I211)

    Gene ID
    Molecular Construction
    N-term
    GDNF (S78-I211)
    Accession # P48540
    C-term
    Protein Length

    Full Length of GDNF

    Synonyms
    rMuGDNF; GDNF; ATF
    AA Sequence

    SPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

    Molecular Weight

    Approximately 17-22 kDa, based on SDS-PAGE under reducing conditions.

    Glycosylation
    Yes
    Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    Appearance

    Lyophilized powder

    Formulation

    Lyophilized from a 0.22 μm filtered solution of PBS.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    GDNF Protein, Mouse (CHO)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    GDNF Protein, Mouse (CHO)
    Cat. No.:
    HY-P7359
    Quantity:
    MCE Japan Authorized Agent: