1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. GDNF Protein, Mouse (CHO)

GDNF Protein, Mouse (CHO)

Cat. No.: HY-P7359
Handling Instructions

GDNF Protein, Mouse (CHO) is a member of a group of closely related neurotrophic factors, functions in the nervous system.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $210 Ask For Quote & Lead Time
50 μg $620 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

CHO

Tag

Tag Free

Accession

P48540 (S78-I211)

Gene ID

14573

Synonyms
rMuGDNF; GDNF; ATF
AA Sequence

MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Molecular Weight

17-22 kDa

Biological Activity
The ED50 is <8 µg/mL as measured by C6 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Adiponectin is a 30-kDa adipose-derived hormone that appears to play an important role in regulating energy homeostasis and insulin sensitivity. The globular head group of adiponectin (gAcrp30) reduces plasma glucose levels and ameliorates insulin resistance in mice[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDNF Protein, Mouse (CHO)
Cat. No.:
HY-P7359
Quantity:
MCE Japan Authorized Agent: