1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. GSTK1 Protein, Human (GST)

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag.

Background

GSTK1 (Glutathione S-transferase kappa 1) is an enzyme that belongs to the glutathione S-transferase family and is involved in the catalysis of glutathione conjugation to both exogenous and endogenous compounds. Its significant glutathione conjugating activity is particularly notable with the model substrate 1-chloro-2,4-dinitrobenzene (CDNB).

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q9Y2Q3-1 (G2-L226)

Gene ID
Molecular Construction
N-term
GST
GSTK1 (G2-L226)
Accession # Q9Y2Q3-1
C-term
Protein Length

Partial

Synonyms
Glutathione S-transferase kappa 1; GST 13-13; GSTK1-1; Glutathione S-transferase subunit 13
AA Sequence

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Predicted Molecular Mass
52.4 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

GSTK1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

GSTK1 Protein, Human (GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GSTK1 Protein, Human (GST)
Cat. No.:
HY-P700381
수량:
MCE Japan Authorized Agent: