Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST)

The GSTK1 protein acts as a glutathione S-transferase, promoting the binding of glutathione to exogenous and endogenous compounds, mainly through the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). active activity. This enzymatic activity plays a vital role in the detoxification process, assisting in the binding of glutathione to various substrates. Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST) is the recombinant human-derived Glutathione S-transferase kappa 1/GSTK1 protein, expressed by E. coli , with N-GST labeled tag. The total length of Glutathione S-transferase kappa 1/GSTK1 Protein, Human (GST) is 225 a.a., with molecular weight of 52.4 kDa.

GSTK1 (Glutathione S-transferase kappa 1) is an enzyme that belongs to the glutathione S-transferase family and is involved in the catalysis of glutathione conjugation to both exogenous and endogenous compounds. Its significant glutathione conjugating activity is particularly notable with the model substrate 1-chloro-2,4-dinitrobenzene (CDNB). This enzymatic activity suggests a role for GSTK1 in detoxification processes, where it facilitates the conjugation of glutathione to various xenobiotic and endogenous compounds, aiding in their elimination from the cell.

Human

E. coli

N-GST

Q9Y2Q3 (G2-L226)

373156  [NCBI]

GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

52.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.