HAS2 Protein, Mouse (His)
Based on 1 Customer Validation
The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag.
HAS2 protein plays a pivotal role in hyaluronan synthesis by catalyzing the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. As a key isozyme involved in this process, HAS2 contributes significantly to the formation of high molecular mass hyaluronan, a major component of most extracellular matrices. This hyaluronan polymer, with its structural role in tissue architectures, plays a crucial role in regulating cell adhesion, migration, and differentiation. HAS2's importance extends to developmental processes, as it is required for the transition of endocardial cushion cells into mesenchymal cells, a critical step in heart development. Additionally, HAS2 may play a role in vasculogenesis. The synthesis of high molecular mass hyaluronan by HAS2 is particularly noteworthy in early contact inhibition, a cellular process that halts growth upon cell contact with other cells or the extracellular matrix. In summary, HAS2 emerges as a central player in the intricate orchestration of hyaluronan-mediated cellular and developmental functions.
1.Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 6.293 ng/mL, corresponding to a specific activity is 1.59×105 units/mg.
2.Measured by its ability to transfer GlcNAc and GlcA from donor substrates to Hyaluronan that incubate at 37°C for 20 min. The specific activity is >40 pmol/min/μg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P70312 (E67-L374)
-
Molecular Construction
-
N-term
-
6*His
-
HAS2 (E67-L374)
Accession # P70312 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
-
AA Sequence
EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
-
Molecular Weight
Approximately 36-38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
-
≥ 90%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0, 1 mM EDTA, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)