HAS2 Protein, Mouse (His)

The HAS2 protein adds GlcNAc or GlcUA monosaccharides to hyaluronic acid, playing a crucial role in its synthesis. HAS2 Protein, Mouse (His) is the recombinant mouse-derived HAS2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HAS2 Protein, Mouse (His) is 308 a.a., with molecular weight of ~39.9 kDa.

HAS2 protein plays a pivotal role in hyaluronan synthesis by catalyzing the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. As a key isozyme involved in this process, HAS2 contributes significantly to the formation of high molecular mass hyaluronan, a major component of most extracellular matrices. This hyaluronan polymer, with its structural role in tissue architectures, plays a crucial role in regulating cell adhesion, migration, and differentiation. HAS2's importance extends to developmental processes, as it is required for the transition of endocardial cushion cells into mesenchymal cells, a critical step in heart development. Additionally, HAS2 may play a role in vasculogenesis. The synthesis of high molecular mass hyaluronan by HAS2 is particularly noteworthy in early contact inhibition, a cellular process that halts growth upon cell contact with other cells or the extracellular matrix. In summary, HAS2 emerges as a central player in the intricate orchestration of hyaluronan-mediated cellular and developmental functions.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

E. coli

N-6*His

P70312 (E67-L374)

15117  [NCBI]

EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL

Approximately 39.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.