Copy Link Print Information

HE4/WFDC2 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for HE4/WFDC2 Protein, Human (HEK293, His)
  • HE4/WFDC2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

HE4/WFDC2 protein is a broad range protease inhibitor that forms homotrimers through disulfide linkages. It is involved in various physiological processes, including regulation of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. This protein acts as a brainstem-restricted receptor and interacts with its ligand, GDF15. Upon binding, HE4/WFDC2 protein interacts with RET and activates MAPK- and AKT-signaling pathways. The extracellular domain of HE4/WFDC2 protein is responsible for interacting with GDF15 and RET, functioning as a receptor for GDF15 and mediating cellular signaling through the interaction with RET following GDF15 binding. Notably, the interaction with RET is dependent on prior binding of GDF15.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q14508 (E31-F124)

  • Gene ID
    10406  [NCBI]
  • Molecular Construction
    • N-term
    • HE4 (E31-F124)
      Accession # Q14508
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    WFDC2; WAP Four-Disulfide Core Domain 2; WAP5; HE4; WAP Four-Disulfide Core Domain Protein 2; DJ461P17.6; EDDM4; Major Epididymis-Specific Protein E4; Putative Protease Inhibitor WAP5; Epididymal Secretory Protein E4; Human Epididymis Protein 4; Epididyma

  • AA Sequence

    EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

  • Predicted Molecular Mass

    11.1 kDa

  • Molecular Weight

    Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • HE4/WFDC2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for HE4/WFDC2 Protein, Human (HEK293, His)
  • HE4/WFDC2 Protein, Human (HEK293, His) Product Image