HE4/WFDC2 Protein, Human (HEK293, His)

The HE4/WFDC2 protein is a homotrimeric broad-spectrum protease inhibitor that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. As a brainstem-restricted receptor, it binds to GDF15 and interacts with RET, activating MAPK and AKT signaling pathways. HE4/WFDC2 Protein, Human (HEK293, His) is the recombinant human-derived HE4/WFDC2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of HE4/WFDC2 Protein, Human (HEK293, His) is 94 a.a., with molecular weight of 18-22 kDa.

HE4/WFDC2 protein is a broad range protease inhibitor that forms homotrimers through disulfide linkages. It is involved in various physiological processes, including regulation of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. This protein acts as a brainstem-restricted receptor and interacts with its ligand, GDF15. Upon binding, HE4/WFDC2 protein interacts with RET and activates MAPK- and AKT-signaling pathways. The extracellular domain of HE4/WFDC2 protein is responsible for interacting with GDF15 and RET, functioning as a receptor for GDF15 and mediating cellular signaling through the interaction with RET following GDF15 binding. Notably, the interaction with RET is dependent on prior binding of GDF15.

Human

HEK293

C-6*His

Q14508 (E31-F124)

10406  [NCBI]

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

18-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.