1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T Related Proteins CD Antigens Receptor Proteins Enzymes & Regulators
  3. EGF Superfamily ErbB2/HER2 Stem Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. ErbB2/CD340 EGFR/ErbB family
  5. HER2/CD340 Protein, Human (142a.a, HEK293, His)

HER2/CD340 Protein, Human (142a.a, HEK293, His)

Cat. No.: HY-P73095
Handling Instructions

The HER2/CD340 protein is a dynamic tyrosine kinase that is essential in the neuregulin receptor complex and regulates microtubule dynamics. Upon activation, it triggers the MEMO1-RHOA-DIAPH1 pathway, inhibits GSK3B and promotes the association of APC and CLASP2 on the cell membrane to achieve microtubule stabilization. HER2/CD340 Protein, Human (142a.a, HEK293, His) is the recombinant human-derived HER2/CD340 protein, expressed by HEK293 , with C-His labeled tag. The total length of HER2/CD340 Protein, Human (142a.a, HEK293, His) is 142 a.a., with molecular weight of ~27 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
50 μg $475 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HER2/CD340 protein is a dynamic tyrosine kinase that is essential in the neuregulin receptor complex and regulates microtubule dynamics. Upon activation, it triggers the MEMO1-RHOA-DIAPH1 pathway, inhibits GSK3B and promotes the association of APC and CLASP2 on the cell membrane to achieve microtubule stabilization. HER2/CD340 Protein, Human (142a.a, HEK293, His) is the recombinant human-derived HER2/CD340 protein, expressed by HEK293 , with C-His labeled tag. The total length of HER2/CD340 Protein, Human (142a.a, HEK293, His) is 142 a.a., with molecular weight of ~27 kDa.

Background

HER2/CD340 Protein, a dynamic protein tyrosine kinase, stands as a pivotal component within diverse cell surface receptor complexes, requiring a coreceptor for efficient ligand binding. Crucially, it plays an indispensable role as part of the neuregulin-receptor complex, with GP30 identified as a potential ligand for this receptor. Beyond its receptor functions, HER2/CD340 Protein intricately regulates the outgrowth and stabilization of peripheral microtubules (MTs). Upon activation, the MEMO1-RHOA-DIAPH1 signaling pathway, initiated by ERBB2 activation, orchestrates the phosphorylation and subsequent inhibition of GSK3B at the cell membrane. This strategic inhibition prevents the phosphorylation of APC and CLASP2, facilitating their association with the cell membrane. Notably, membrane-bound APC enables the localization of MACF1 to the cell membrane, a prerequisite for microtubule capture and stabilization. Within the nucleus, HER2/CD340 Protein is actively involved in transcriptional regulation, associating with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter to activate transcription. Furthermore, its engagement in the transcription of rRNA genes by RNA Pol I enhances protein synthesis, contributing to overall cell growth. The multifaceted activities of HER2/CD340 Protein underscore its central role in orchestrating diverse cellular processes, ranging from receptor signaling to microtubule dynamics and transcriptional regulation.

Species

Human

Source

HEK293

Tag

C-His

Accession

P04626/NP_004439.2 (P489-C630)

Gene ID
Molecular Construction
N-term
HER2 (P489-C630)
Accession # P04626
His
C-term
Synonyms
Receptor tyrosine-protein kinase erbB-2; MLN 19; CD340; ERBB2; HER2; NEU; NGL
AA Sequence

PHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINC

Molecular Weight

Approximately 27 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HER2/CD340 Protein, Human (142a.a, HEK293, His)
Cat. No.:
HY-P73095
Quantity:
MCE Japan Authorized Agent: