HSPB11 Protein, Human (His)
The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.
HSPB11 protein serves as a crucial component of the IFT complex B, essential for sonic hedgehog/SHH signaling. Its role in intraflagellar transport is particularly prominent in tissues rich in ciliated cells, such as the kidney and testis, where it mediates the transport of SHH components. HSPB11 is indispensable for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to SHH pathway activation, suggesting its involvement in the dynamic transport of SHH signaling molecules within the cilium. While not required for ciliary assembly, HSPB11 plays a pivotal role in male fertility, spermiogenesis, and sperm flagella formation. Additionally, it contributes to the early development of the kidney and may be involved in the regulation of ureteric bud initiation. As part of the IFT complex B, HSPB11 interacts with other components such as IFT27 and IFT88, highlighting its integral role in the intricate machinery of intraflagellar transport and ciliary function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y547 (M1-S144)
-
Molecular Construction
-
N-term
-
6*His
-
HSPB11 (M1-S144)
Accession # Q9Y547 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
IFT25; CFAP232; Prev. C1orf41; Heat Shock Protein Family B (Small), Member 11; Prev. HSPB11; Heat Shock Protein Family B (Small) Member 11; PP25; Heat Shock Protein Family B Member 11; Intraflagellar Transport Protein 25 Homolog; Intraflagellar Transport
-
AA Sequence
MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS
-
Predicted Molecular Mass
18.5 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
