1. Recombinant Proteins
  2. Others
  3. HSPB11 Protein, Human (His)

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag.

Background

HSPB11 protein serves as a crucial component of the IFT complex B, essential for sonic hedgehog/SHH signaling. Its role in intraflagellar transport is particularly prominent in tissues rich in ciliated cells, such as the kidney and testis, where it mediates the transport of SHH components. HSPB11 is indispensable for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to SHH pathway activation, suggesting its involvement in the dynamic transport of SHH signaling molecules within the cilium. While not required for ciliary assembly, HSPB11 plays a pivotal role in male fertility, spermiogenesis, and sperm flagella formation. Additionally, it contributes to the early development of the kidney and may be involved in the regulation of ureteric bud initiation. As part of the IFT complex B, HSPB11 interacts with other components such as IFT27 and IFT88, highlighting its integral role in the intricate machinery of intraflagellar transport and ciliary function.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y547 (M1-S144)

Gene ID
Molecular Construction
N-term
6*His
HSPB11 (M1-S144)
Accession # Q9Y547
C-term
Protein Length

Full Length

Synonyms
Heat Shock Protein Beta-11; Hspb11; Placental Protein 25; PP25; HSPB11; C1orf41
AA Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Predicted Molecular Mass
18.5 kDa
Peso molecular

Approximately 21 kDa,based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

HSPB11 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

HSPB11 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
HSPB11 Protein, Human (His)
Cat. No.:
HY-P70945
Cantidad:
MCE Japan Authorized Agent: