1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-lambda
  5. IFN-lambda 2/IL-28A
  6. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, His, solution)

IFN-lambda 2/IL-28A Protein, Mouse (HEK293, His, solution)

Cat. No.: HY-P7991
SDS COA Handling Instructions Technical Support

IFN-lambda 2/IL-28A Protein, Mouse (HEK 293, His), a type III interferon, is a member of IL-10-interferon family. IFN-lambda 2/IL-28A Protein shows anti-viral, anti-tumor and immune stimulatory properties.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-lambda 2/IL-28A Protein, Mouse (HEK 293, His), a type III interferon, is a member of IL-10-interferon family. IFN-lambda 2/IL-28A Protein shows anti-viral, anti-tumor and immune stimulatory properties.

Background

Interferon lambdas (IFN-λs; IFNL1-4) modulate immunity in the context of infections and autoimmune diseases, through a network of induced genes. IL-28A, IL-28B and IL-29 (also designated type III interferons) constitute a new subfamily within the IL-10-interferon family. IL-28A, IL-28B and IL-29 share a common cellular receptor consisting of the cytokine receptor family class II members IL-28R1 (also designated IFN-λR1, LICR2 and CRF2/12) and IL-10R2. IL-28A was shown to reduce viral replication or the cytopathic effect of a range of viruses, including the DNA viruses murine CMV, hepatitis B virus and herpes simplex virus 2, the ss (+) RNA viruses EMCV, west nile virus and hepatitis C virus, as well as the ss (-) RNA viruses vesicular stomatitis virus, influenza-A virus and Hantaan virus[1][2].

Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q4VK74 (D20-193V)

Gene ID
Molecular Construction
N-term
6*His
IFN-λ2 (D20-193V)
Accession # Q4VK74
C-term
Synonyms
Interferon-λ2, IFN-λ2, IL-28A
AA Sequence

DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

Molecular Weight

Approximately 21.8 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IFN-lambda 2/IL-28A Protein, Mouse (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-lambda 2/IL-28A Protein, Mouse (HEK293, His, solution)
Cat. No.:
HY-P7991
Quantity:
MCE Japan Authorized Agent: