Copy Link Print Information

IGFBP-1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IGFBP-1 protein extends the half-life of IGFs and modulates their activity. It can inhibit or stimulate IGFs' growth-promoting effects, altering their interaction with receptors and fine-tuning signaling pathways. IGFBP-1 promotes cell migration and binds to both IGF1 and IGF2, highlighting its versatile role in modulating IGF signaling pathways. IGFBP-1 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IGFBP-1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGFBP-1 protein extends the half-life of IGFs and modulates their activity. It can inhibit or stimulate IGFs' growth-promoting effects, altering their interaction with receptors and fine-tuning signaling pathways. IGFBP-1 promotes cell migration and binds to both IGF1 and IGF2, highlighting its versatile role in modulating IGF signaling pathways. IGFBP-1 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

IGFBP-1 protein assumes a crucial role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. With a dual regulatory influence in cell culture, IGFBP-1 can either inhibit or stimulate the growth-promoting effects of IGFs, highlighting its versatile impact on cellular processes. Additionally, IGFBP-1 is involved in altering the interaction between IGFs and their cell surface receptors, contributing to the fine-tuning of signaling pathways associated with IGF-mediated cellular responses. Notably, IGFBP-1 promotes cell migration, underscoring its broader involvement in cellular dynamics. Importantly, it exhibits an equal affinity for binding to both IGF1 and IGF2, indicating its ability to interact with multiple IGF isoforms and emphasizing the complexity of IGFBP-1's role in modulating IGF signaling pathways.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P08833 (A26-N259)

  • Gene ID
    3484  [NCBI]
  • Molecular Construction
    • N-term
    • IGFBP-1 (A26-N259)
      Accession # P08833
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IGFBP1; Alpha-Pregnancy-Associated Endometrial Globulin; Prev. IBP1; Amniotic Fluid Binding Protein; PP12; Binding Protein-28; Insulin-Like Growth Factor-Binding Protein 1; Binding Protein-26; IGF-Binding Protein 1; Binding Protein-25; Placental Protein 1

  • AA Sequence

    APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

  • Predicted Molecular Mass

    26.1 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IGFBP-1 Protein, Human (HEK293, His) Product Image
    1/16
  • IGFBP-1 Protein, Human (HEK293, His) Product Image