1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. IGF family
  4. IGFBP-1
  5. IGFBP-1 Protein, Human (HEK293, His)

IGFBP-1 Protein, Human (HEK293, His)

Cat. No.: HY-P72608
COA Handling Instructions

IGFBP-1 protein extends the half-life of IGFs and modulates their activity. It can inhibit or stimulate IGFs' growth-promoting effects, altering their interaction with receptors and fine-tuning signaling pathways. IGFBP-1 promotes cell migration and binds to both IGF1 and IGF2, highlighting its versatile role in modulating IGF signaling pathways. IGFBP-1 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IGFBP-1 Protein, Human (HEK293, His) is 234 a.a., with molecular weight of 30-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $130 In-stock
50 μg $365 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IGFBP-1 protein extends the half-life of IGFs and modulates their activity. It can inhibit or stimulate IGFs' growth-promoting effects, altering their interaction with receptors and fine-tuning signaling pathways. IGFBP-1 promotes cell migration and binds to both IGF1 and IGF2, highlighting its versatile role in modulating IGF signaling pathways. IGFBP-1 Protein, Human (HEK293, His) is the recombinant human-derived IGFBP-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IGFBP-1 Protein, Human (HEK293, His) is 234 a.a., with molecular weight of 30-35 kDa.

Background

IGFBP-1 protein assumes a crucial role in modulating the activity of insulin-like growth factors (IGFs) by extending their half-life. With a dual regulatory influence in cell culture, IGFBP-1 can either inhibit or stimulate the growth-promoting effects of IGFs, highlighting its versatile impact on cellular processes. Additionally, IGFBP-1 is involved in altering the interaction between IGFs and their cell surface receptors, contributing to the fine-tuning of signaling pathways associated with IGF-mediated cellular responses. Notably, IGFBP-1 promotes cell migration, underscoring its broader involvement in cellular dynamics. Importantly, it exhibits an equal affinity for binding to both IGF1 and IGF2, indicating its ability to interact with multiple IGF isoforms and emphasizing the complexity of IGFBP-1's role in modulating IGF signaling pathways.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P08833 (A26-N259)

Gene ID
Molecular Construction
N-term
IGFBP-1 (A26-N259)
Accession # P08833
6*His
C-term
Synonyms
Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1; PP12
AA Sequence

APWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IGFBP-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGFBP-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P72608
Quantity:
MCE Japan Authorized Agent: