IGF-I/IGF-1 Protein, Mouse (N-His)

The IGF-I/IGF-1 protein is structurally similar to insulin and has potent growth-promoting activity. As a physiological regulator, it stimulates glucose transport and glycogen synthesis in osteoblasts, exceeding the efficacy of insulin at lower concentrations. IGF-I/IGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived IGF-I/IGF-1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IGF-I/IGF-1 Protein, Mouse (N-His) is 70 a.a., with molecular weight of ~10 kDa.

The IGF-I/IGF-1 protein, akin to insulin in structure and function, demonstrates significantly heightened growth-promoting activity. As a physiological regulator, it may govern [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts, effectively stimulating glucose transport in bone-derived osteoblastic (PyMS) cells at markedly lower concentrations than insulin. Additionally, IGF-I may contribute to synapse maturation and Ca(2+)-dependent exocytosis, crucial for sensory perception of smell in the olfactory bulb. Acting as a ligand for IGF1R, it binds to the alpha subunit, triggering the activation of intrinsic tyrosine kinase activity, which leads to autophosphorylation of tyrosine residues in the beta subunit. This initiation sets off a cascade of downstream signaling events, activating the PI3K-AKT/PKB and Ras-MAPK pathways. IGF-I also forms essential ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1 for comprehensive IGF1 signaling, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1. Moreover, it interacts with SH2D3C isoform 2, highlighting its diverse molecular engagements.

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells.The ED₅₀ for this effect is 3.972-6.159 ng/mL, corresponding to a specific activity is 1.623×10⁵ - 2.517×10⁵ units/mg.

• 
  Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells.The ED₅₀ for this effect is 3.972 ng/mL, corresponding to a specific activity is 2.517×10⁵ units/mg.

Mouse

E. coli

N-6*His

P05017 (G49-A118)

16000  [NCBI]

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.