IgG3 Fc Protein, Human (HEK293)
Based on 1 Customer Validation
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. IgG3 Fc Protein, Human (HEK293) is the recombinant human-derived IgG3 Fc protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IgG3 Fc protein is the constant region of an immunoglobulin heavy chain that acts as a receptor for a specific antigen. IgG3 Fc Protein, Human (HEK293) is the recombinant human-derived IgG3 Fc protein, expressed by HEK293 , with tag free.
Background
The constant region of immunoglobulin heavy chains, known as antibodies, represents membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, these membrane-bound immunoglobulins act as receptors that, upon binding a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. Secreted immunoglobulins play a pivotal role in the effector phase of humoral immunity, leading to the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain, resulting in each immunoglobulin having two antigen binding sites with remarkable affinity for a particular antigen. The variable domains undergo a V-(D)-J rearrangement and subsequent somatic hypermutations, enabling affinity maturation for a specific antigen after exposure and selection. Immunoglobulins are comprised of two identical heavy chains and two identical light chains, held together by disulfide linkages.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P01860-1 (E99-K377)
-
Gene ID3502
-
Molecular Construction
-
N-term
-
IgG3 Fc (E99-K377)
Accession # P01860-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
IGHG3; Secrete-Type Ig Gamma Heavy-Chain; Immunoglobulin Heavy Constant Gamma 3 (G3m Marker); Heavy Chain Disease Protein; Immunoglobulin Heavy Constant Gamma 3 (Gm Marker); Ig Gamma-3 Chain C Region; Constant Region Of Heavy Chain Of IgG3; C Gamma 3; Imm
-
AA Sequence
ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK
-
Predicted Molecular Mass
31.2 kDa
-
Molecular Weight
Approximately 35-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)