IL-18 Protein, Rat

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

Interleukin (IL)-18 is a potent stimulator of immunity and augments the severity of type II collagen-induced arthritis (CIA) in rats and mice by enhancing T helper 1 (Th1) cell activation, which increases the production of proinflammatory cytokines and arthritogenic antibodies. IL-18 possesses immunoregulatory activities, including the stimulation of interferon (IFN)-g production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation^[1].

The ED₅₀ is <2 μg/mL as measured by KG-1 cells, corresponding to a specific activity of >500 units/mg.

Rat

E. coli

Tag Free

P97636 (H37-S194)

29197  [NCBI]

MHFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Approximately 18.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 50 mM Tris, 50 mM NaCl, pH 8.0.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ye XJ, et al. The effects of interleukin-18 on rat articular chondrocytes: a study of mRNA expression and protein synthesis of proinflammatory substances. Clin Exp Immunol. 2007 Sep;149(3):553-60.  [Content Brief]