1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18 Protein, Rat

IL-18 Protein, Rat

Cat. No.: HY-P7210
Handling Instructions

IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN)-γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $570 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

IL-18 Protein, Rat Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

P97636 (H37-S194)

Gene ID

29197

Synonyms
rRtIL-18; Interferon-gamma-inducing factor; IL-1 gamma
AA Sequence

MHFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Molecular Weight

Approximately 18.4 kDa

Biological Activity
The ED50 is <2 μg/mL as measured by KG-1 cells, corresponding to a specific activity of >500 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 50 mM Tris, 50 mM NaCl, pH 8.0.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin (IL)-18 is a potent stimulator of immunity and augments the severity of type II collagen-induced arthritis (CIA) in rats and mice by enhancing T helper 1 (Th1) cell activation, which increases the production of proinflammatory cytokines and arthritogenic antibodies. IL-18 possesses immunoregulatory activities, including the stimulation of interferon (IFN)-g production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18 Protein, Rat
Cat. No.:
HY-P7210
Quantity:
MCE Japan Authorized Agent: