IL-1RA/IL-1RN Protein, Mouse

IL-1RN protein serves as an anti-inflammatory antagonist, targeting proinflammatory cytokines IL1B and IL1A within the interleukin-1 family. Playing a protective role, it prevents immune dysregulation and systemic inflammation induced by IL1, particularly in response to innate stimulatory agents. IL-1RN's regulatory activity contributes to a balanced immune response, safeguarding the host from the detrimental effects of excessive inflammation. IL-1RA/IL-1RN Protein, Mouse is the recombinant mouse-derived IL-1RA/IL-1RN protein, expressed by E. coli , with tag free. The total length of IL-1RA/IL-1RN Protein, Mouse is 152 a.a., with molecular weight of ~18 kDa.

The IL-1RN protein functions as an anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Acting as a protective barrier, this protein plays a crucial role in preventing immune dysregulation and uncontrolled systemic inflammation induced by IL1, particularly in response to various innate stimulatory agents such as pathogens. Its regulatory activity contributes to maintaining a balanced immune response and safeguarding the host from the detrimental effects of excessive inflammation.

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 cells. The ED₅₀ for this effect is ≤64.28 ng/mL in the presence of 50 pg/mL of recombinant human IL-1 alpha, corresponding to a specific activity is ≥1.56×10⁴ units/mg.

• 
  Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 cells.The ED₅₀ for this effect is 64.28 ng/mL in the presence of 50 pg/mL of recombinant human IL-1 alpha, corresponding to a specific activity is 1.56×10⁴ units/mg.

Mouse

E. coli

Tag Free

P25085 (R27-Q178)

16181  [NCBI]

RPSGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNIKLEEKIDMVPIDLHSVFLGIHGGKLCLSCAKSGDDIKLQLEEVNITDLSKNKEEDKRFTFIRSEKGPTTSFESAACPGWFLCTTLEADRPVSLTNTPEEPLIVTKFYFQEDQ

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.