IL-1RA/IL-1RN Protein, Rat (HEK293, Fc)

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-1RA/IL-1RN protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is 152 a.a., with molecular weight of ~41.81 kDa.

The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is 99.07 ng/mL in the presence of 50 pg/mL of IL-1 alpha, corresponding to a specific activity is 1.009×10^4 units/mg.

• 
  Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is 99.07 ng/mL in the presence of 50 pg/mL of IL-1 alpha, corresponding to a specific activity is 1.009×10₄ units/mg.

Rat

HEK293

N-hFc

P25086 (H27-Q178)

60582  [NCBI]

HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ

Approximately 41.81 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.