1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-1RA
  5. IL-1RA/IL-1RN Protein, Rat (HEK293, Fc)

IL-1RA/IL-1RN Protein, Rat (HEK293, Fc)

Cat. No.: HY-P73187
COA Handling Instructions

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-1RA/IL-1RN protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is 152 a.a., with molecular weight of ~41.81 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $36 In-stock
10 μg $100 In-stock
50 μg $280 In-stock
100 μg $476 In-stock
500 μg $1300 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1RA/IL-1RN mutant proteins are potent anti-inflammatory antagonists of the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. This mutant variant is designed for enhanced suppressive capacity, tightly protecting the host from immune dysregulation and preventing IL1 from triggering uncontrolled systemic inflammation in response to innate stimulators. IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is the recombinant rat-derived IL-1RA/IL-1RN protein, expressed by HEK293 , with N-hFc labeled tag. The total length of IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) is 152 a.a., with molecular weight of ~41.81 kDa.

Background

The IL-1RA/IL-1RN mutant protein functions as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Engineered to enhance its inhibitory capabilities, this mutant variant plays a critical role in safeguarding the host from immune dysregulation and preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. By offering an optimized defense against IL1-mediated inflammatory responses, the mutant protein contributes significantly to maintaining immune balance and preventing excessive inflammation.

Biological Activity

Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL‑2 mouse cytotoxic T cells. The ED50 for this effect is 99.07 ng/mL in the presence of 50 pg/mL of IL-1 alpha, corresponding to a specific activity is 1.009×10^4 units/mg.

  • Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL‑2 mouse cytotoxic T cells. The ED50 for this effect is 99.07 ng/mL in the presence of 50 pg/mL of IL-1 alpha, corresponding to a specific activity is 1.009×104 units/mg.
Species

Rat

Source

HEK293

Tag

N-hFc

Accession

P25086 (H27-Q178)

Gene ID
Molecular Construction
N-term
hFc
IL-1RA (H27-Q178)
Accession # P25086
C-term
Synonyms
Interleukin-1 receptor antagonist protein; IL-1RN; IL-1ra; Il1rn
AA Sequence

HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ

Molecular Weight

Approximately 41.81 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-1RA/IL-1RN Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-1RA/IL-1RN Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73187
Quantity:
MCE Japan Authorized Agent: