IL-21R Protein, Mouse (217a.a, HEK293, His)

The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (217a.a, HEK293, His) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-21R Protein, Mouse (217a.a, HEK293, His) is 217 a.a., with molecular weight of 34-38 kDa.

IL-21R Protein functions as a receptor specifically designed for interleukin-21, forming a heterodimeric complex with the common gamma subunit. This receptor complex, crucial for transducing signals initiated by interleukin-21, enables cellular responses to this cytokine. The IL-21R heterodimeric structure facilitates its interaction with Janus kinase 1 (JAK1), playing a pivotal role in initiating downstream signaling events in response to interleukin-21 binding. The association of IL-21R with the common gamma subunit and its interaction with JAK1 collectively contribute to the transduction of interleukin-21-mediated signals, thus influencing various cellular processes and immune responses.

Mouse

HEK293

C-6*His

Q9JHX3 (C20-P236)

60504  [NCBI]

CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP

34-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.