IL-21R Protein, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Interleukin 21 receptor (IL-21R), a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). Through this interaction, the receptor facilitates the signaling cascade initiated by interleukin-21, a cytokine with diverse immunoregulatory functions. The formation of the IL-21R heterodimer and its association with JAK1 are pivotal steps in transducing the cellular responses triggered by interleukin-21, contributing to the regulation of immune processes and inflammatory pathways. IL-21R is highly expressed in hematological malignancies and enhances the aggressiveness of follicular lymphoma. IL-21R results in the pathogenesis of leukemia and large cell lymphoma through activation of the JAK/STAT signaling pathway. The knockdown of IL-21R markedly suppressed GC cell proliferation and invasion, and IL-21R expression was further validated to be negatively regulated by miR-125a-3p (miR-125a). Moreover, it reduces the growth and invasion of NSCLC cells via inhibiting Wnt/β‑catenin signaling and PD‑L1 expression^[1][2].

Measured by its binding ability in a functional ELISA. Immobilized Human IL-21 at 5 μg/mL (100 μL/well) can bind Rat IL-21R, the ED₅₀ for this effect is 28.13 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human IL-21 at 5 μg/mL (100 μL/well) can bind Rat IL-21R, the ED₅₀ for this effect is 28.13 ng/mL.

Rat

HEK293

C-His

Q5EBB1 (C20-P236)

308977  [NCBI]

Partial

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

32-50 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.