1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-27
  5. IL-27 Protein, Mouse (228a.a, HEK293, C-His)

IL-27 Protein, Mouse (228a.a, HEK293, C-His)

Cat. No.: HY-P73200A
COA Handling Instructions

IL-27 Proteinas, along with IL23A, forms the IL-23 interleukin, a key cytokine in innate and adaptive immunity. It's implicated in infection response, binding to the IL12RB1 and IL23R receptor complex, activating Jak-Stat signaling. IL-23 stimulates memory T-cells, promoting pro-inflammatory cytokine production. It contributes to autoimmune inflammation and is implicated in tumorigenesis. IL-12, a growth factor for activated T and NK cells, enhances NK cell lytic activity and stimulates interferon-gamma production by resting PBMC. IL-27 Protein, Mouse (228a.a, HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide. IL-27 Protein, Mouse (228a.a, HEK293, C-His), has molecular weight of ~57.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $32 In-stock
10 μg $90 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-27 Proteinas, along with IL23A, forms the IL-23 interleukin, a key cytokine in innate and adaptive immunity. It's implicated in infection response, binding to the IL12RB1 and IL23R receptor complex, activating Jak-Stat signaling. IL-23 stimulates memory T-cells, promoting pro-inflammatory cytokine production. It contributes to autoimmune inflammation and is implicated in tumorigenesis. IL-12, a growth factor for activated T and NK cells, enhances NK cell lytic activity and stimulates interferon-gamma production by resting PBMC. IL-27 Protein, Mouse (228a.a, HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide. IL-27 Protein, Mouse (228a.a, HEK293, C-His), has molecular weight of ~57.6 kDa.

Background

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Biological Activity

Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×10^4 units/mg.

  • Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 for this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×104 units/mg.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O35228 (Y19-P228) & GSGSGGSGGSGSGKL & Q8K3I6 (F29-S234)

Gene ID

50498&246779

Synonyms
Interleukin-27 subunit beta; IL-27B; Ebi3; Interleukin-27 subunit alpha; IL-27A; p28
AA Sequence

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Weight

Approximately 57.6 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-27 Protein, Mouse (228a.a, HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-27 Protein, Mouse (228a.a, HEK293, C-His)
Cat. No.:
HY-P73200A
Quantity:
MCE Japan Authorized Agent: