IL-27 Protein, Mouse (228a.a, HEK293, C-His)

IL-27 Proteinas, along with IL23A, forms the IL-23 interleukin, a key cytokine in innate and adaptive immunity. It's implicated in infection response, binding to the IL12RB1 and IL23R receptor complex, activating Jak-Stat signaling. IL-23 stimulates memory T-cells, promoting pro-inflammatory cytokine production. It contributes to autoimmune inflammation and is implicated in tumorigenesis. IL-12, a growth factor for activated T and NK cells, enhances NK cell lytic activity and stimulates interferon-gamma production by resting PBMC. IL-27 Protein, Mouse (228a.a, HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide. IL-27 Protein, Mouse (228a.a, HEK293, C-His), has molecular weight of ~57.6 kDa.

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED₅₀ this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×10^4 units/mg.

• 
  Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED₅₀ for this effect is 52.01 ng/ml, corresponding to a specific activity is 1.923×10⁴ units/mg.

Mouse

HEK293

C-10*His

O35228 (Y19-P228) & GSGSGGSGGSGSGKL & Q8K3I6 (F29-S234)

50498&246779

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Approximately 57.6 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.