Copy Link Print Information

IL-27 Protein, Mouse (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

IL-27 is a crucial pleiotropic immunoregulatory molecule within the IL-12 cytokine family, playing a pivotal role in "bidirectional regulation" to maintain immune homeostasis. IL-27 induces the differentiation of naive CD4+ T cells into Th1 cells and promotes the secretion of cytokines such as IFN-γ. Simultaneously, IL-27 restricts the differentiation of Th2 and Th17 cells and reduces the release of pro-inflammatory factors, thereby effectively suppressing autoimmune inflammation and allergic reactions. IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein consisting of IL27A and IL27B subunits expressed in HEK293 cells, featuring a C-terminal 10×His tag and a GSGSGGSGGSGSGKL peptide.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, C-His)
  • IL-27 Protein, Mouse (HEK293, C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-27 is a crucial pleiotropic immunoregulatory molecule within the IL-12 cytokine family, playing a pivotal role in "bidirectional regulation" to maintain immune homeostasis. IL-27 induces the differentiation of naive CD4+ T cells into Th1 cells and promotes the secretion of cytokines such as IFN-γ. Simultaneously, IL-27 restricts the differentiation of Th2 and Th17 cells and reduces the release of pro-inflammatory factors, thereby effectively suppressing autoimmune inflammation and allergic reactions. IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein consisting of IL27A and IL27B subunits expressed in HEK293 cells, featuring a C-terminal 10×His tag and a GSGSGGSGGSGSGKL peptide.

Background

IL-27 is a heterodimer formed by two subunits linked via disulfide bonds: the IL-27-specific p28 subunit and the EBI3 subunit, which is shared with IL-35. It is primarily synthesized and secreted by antigen-presenting cells—such as dendritic cells, macrophages, and other myeloid cells—in response to stimulation by pathogens or inflammatory signals. IL-27 exerts its biological effects by binding to a heterodimeric receptor complex on the surface of target cells (composed of IL-27Rα and gp130), thereby activating downstream JAK/STAT signaling pathways (primarily involving STAT1 and STAT3).

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 this effect is 40-60 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 for this effect is 52.01 ng/mL, corresponding to a specific activity is 1.923×104 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234)

  • Gene ID
    50498&246779
  • Synonyms

    EBI3; IL-27 Subunit Beta; Epstein-Barr Virus Induced 3; IL27 Subunit; IL27B; IL35 Subunit; IL35B; IL-27B; Epstein-Barr Virus-Induced Gene 3 Protein; Epstein-Barr Virus Induced Gene 3; Interleukin-27 Subunit Beta; Cytokine Receptor; EBV-Induced Gene 3 Prot

  • AA Sequence

    YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

  • Predicted Molecular Mass

    49.5 kDa

  • Molecular Weight

    Approximately 58-65 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 Human Erythroleukemia Cells. The ED50 for this effect is 52.01 ng/mL, corresponding to a specific activity is 1.923×104 units/mg.

  • IL-27 Protein, Mouse (HEK293, C-His) Product Image
    1/16
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, C-His)
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, C-His)
  • IL-27 Protein, Mouse (HEK293, C-His) Product Image