1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. Interleukin & Receptors T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins
  4. IL-2 Receptor CD25/IL-2R alpha
  5. IL-2R alpha
  6. IL-2R alpha/CD25 Protein, Mouse (215a.a, HEK293, His)

IL-2R alpha/CD25 Protein, Mouse (215a.a, HEK293, His)

Cat. No.: HY-P72550
COA Handling Instructions

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions. IL-2R alpha/CD25 Protein, Mouse (215a.a, HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 215 amino acids (E22-K236).

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
10 μg $60 In-stock
50 μg $165 In-stock
100 μg $280 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R alpha (CD25) is an essential component of high-affinity IL-2 receptors. IL-2R alpha enhances binding of IL-2 to its receptor complex so that regulates T cell growth and other lymphoid functions[1][2]. IL-2R alpha/CD25 Protein, Mouse (215a.a, HEK293, His) is a recombinant mouse IL-2R alpha protein with a His tag at the C-terminus and is expressed in HEK293 cells. It consists of 215 amino acids (E22-K236).

Background

IL-2R alpha (CD25) is a type I membrane protein. IL-2R alpha is expressed in peripheral activated T and B cells, triple-negative thymocytes, and bone marrow pre-B cells. In high tumor regulatory T (Treg) cells, IL-2R alpha is highly expressed and is a potential target for Treg deletion. The expression of IL-2R alpha is undetectable on resting T cells[1][2][3].
The sequence of amino acids in IL-2R alpha from different species is very different (less than 85% similarity among human, rat and mouse).
IL-2R alpha is an essential component of high-affinity IL-2 receptors and has no signal-transducing activity per se. IL-2R alpha functions through enhancing binding of IL-2 to its receptor complex and acts as a positive feedback regulator. IL-2 is a principal growth factor for T lymphocytes and plays an important role in T cell immune response. IL-2R alpha transcription is regulated by three positive regulatory regions (PRRs): PRRI, PRRII and PRRIII. PRRIII is an IL-2 response element[1][2].
IL-2R alpha regulates T cell growth, augments lymphocyte activation and proliferation. IL-2R alpha is involved in preventing type 1 diabetes and cancers[1][2][4].

In Vivo

Mouse IL-2 (mIL-2)/CD25 (0.5 mg/kg; s.c.; twice a week for 1 week) induces a robust regulatory T cells (Tregs) expansion without showing signs of increase in the numbers of NK, CD4+ Foxp3, or CD8+ T cells or significant increase in proinflammatory cytokines[5].
Mouse IL-2 (mIL-2)/CD25 (0.2-0.4 mg/kg; s.c.; twice a week for 1 week) demonstrates efficacy in inducing Treg expansion, CD25 upregulation, and inhibiting lupus nephritis based on the levels of proteinuria, autoantibody titers, and kidney histology scores in both NZB ◊ NZW and MRL/lpr mice[5].

Biological Activity

Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.8305 μg/mL in the presence of 30 ng/mL of recombinant human IL-2, corresponding to a specific activity is 1.2×10^3 units/mg.

  • Measured in a cell proliferation assay using MO7e cells. The ED50 for this effect is 0.8305 μg/mL in the presence of 30 ng/mL of recombinant human IL-2, corresponding to a specific activity is 1.2×103 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P01590/NP_032393.3(E22-K236)

Gene ID

16184  [NCBI]

Molecular Construction
N-term
IL-2Rα (E22-K236)
Accession # P01590/NP_032393.3
6*His
C-term
Synonyms
Interleukin-2 receptor subunit alpha; IL-2-RA; CD25; TCGFR; p55
AA Sequence

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK

Molecular Weight

40-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R alpha/CD25 Protein, Mouse (215a.a, HEK293, His)
Cat. No.:
HY-P72550
Quantity:
MCE Japan Authorized Agent: