INSIG2 Protein, Human (Cell-Free, His, Myc)

The INSIG2 protein is a key oxysterol-binding protein that regulates cholesterol synthesis by controlling SCAP transport and HMGCR degradation. As a negative regulator, INSIG2 retains the SCAP-SREBP complex in the endoplasmic reticulum (ER) and inhibits SREBP processing. INSIG2 Protein, Human (Cell-Free, His, Myc) is the recombinant human-derived INSIG2 protein, expressed by E. coli Cell-free , with N-10*His, C-Myc labeled tag. The total length of INSIG2 Protein, Human (Cell-Free, His, Myc) is 225 a.a., with molecular weight of 32.2 kDa.

INSIG2 protein operates as a key oxysterol-binding protein, exerting control over cholesterol synthesis through the modulation of SCAP transport from the endoplasmic reticulum (ER) to the Golgi and the degradation of HMGCR. Functioning as a negative regulator of cholesterol biosynthesis, INSIG2 orchestrates the retention of the SCAP-SREBP complex within the ER, inhibiting the processing of sterol regulatory element-binding proteins (SREBPs), namely SREBF1/SREBP1 and SREBF2/SREBP2. Its binding affinity for oxysterols, including 22-hydroxycholesterol, 24-hydroxycholesterol, 25-hydroxycholesterol, and 27-hydroxycholesterol, finely tunes the interaction with SCAP and retains the SCAP-SREBP complex within the ER. In the presence of oxysterols, INSIG2 hinders SCAP-mediated escorting of SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi. Conversely, sterol deprivation or phosphorylation by PCK1 disrupts oxysterol binding, facilitating the interaction between INSIG2 and SCAP and promoting Golgi transport of the SCAP-SREBP complex. Additionally, INSIG2 regulates cholesterol synthesis by instigating the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR through recruitment to the ubiquitin ligase RNF139. Its interactions with SCAP, SREBF1/SREBP1, SREBF2/SREBP2, and RNF139 play pivotal roles in orchestrating this intricate feedback control mechanism.

Human

E. coli Cell-free

N-10*His;C-Myc

Q9Y5U4 (M1-E225)

51141

MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE

32.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.