Kallikrein-1 Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Kallikrein-1 protein functions by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. In the context of microbial infection, it plays a role in cleaving Neisseria meningitidis NHBA in saliva, with Neisseria being an obligate commensal of the nasopharyngeal mucosa.
Verified Bioactivity
Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFR-AMC). The specific activity is >1,500 pmoles/min/μg. (Activation description: The proenzyme needs to be activated by Thermolysin for an activated form)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
NP_002248.1 (S23-S262)
-
Protein Length
Full Length of Kallikrein-1 Chain
-
Synonyms
KLK1; Kallikrein 1, Renal/Pancreas/Salivary, Isoform CRA_c; Kallikrein 1; Kallikrein 1, Renal/Pancreas/Salivary, Isoform CRA_a; Klk6; Kallikrein 1 Isoform 3 Preproprotein; Kidney/Pancreas/Salivary Gland Kallikrein; Kallikrein Serine Protease 1; Kallikrein
-
AA Sequence
SRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTQEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKVHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
-
Predicted Molecular Mass
28 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE. ≥ 95%, as determined by HPLC.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
