1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution)

Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution)

Cat. No.: HY-P70144
SDS COA Handling Instructions

Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-1 protein cleaves bonds in kininogen to release Lys-bradykinin. It also cleaves Neisseria meningitidis NHBA in saliva during microbial infection.Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution) is the recombinant human-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Kallikrein-1 protein functions by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. In the context of microbial infection, it plays a role in cleaving Neisseria meningitidis NHBA in saliva, with Neisseria being an obligate commensal of the nasopharyngeal mucosa.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH05313.1 (P19-S262)

Gene ID
Synonyms
rHuKallikrein-1/KLK1, His; Kallikrein-1; Kidney/Pancreas/Salivary Gland Kallikrein; Tissue Kallikrein; KLK1
AA Sequence

PPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS

Molecular Weight

38-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 2 mM CaCl2, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-1 Protein, Human (244a.a, HEK293, His, solution)
Cat. No.:
HY-P70144
Quantity:
MCE Japan Authorized Agent: