Copy Link Print Information

Kras4B Protein, Human (184a.a, G12V, His)

Customer Review

Based on 1 Customer Validation

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (184a.a, G12V, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G12V mutation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Kras4B Protein, Human (184a.a, G12V, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. Kras4B Protein, Human (184a.a, G12V, His) is the recombinant human-derived KRAS protein, expressed by E. coli , with N-6*His labeled tag and G12V mutation.

Background

KRAS, a pivotal member of the Ras protein family, exhibits the ability to bind GDP/GTP and possesses intrinsic GTPase activity. Its crucial involvement in the regulation of cell proliferation underscores its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), where it induces transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality highlights KRAS as a key player in cellular dynamics and emphasizes its relevance in both normal and pathological cellular processes.

Verified Bioactivity

Measured by its ability to catalyze the substrate GTP. The specific activity is 2.03 nmol/min/mg, as measured under the described conditions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    AAH13572.1 (T2-C185, G12V)

  • Gene ID
    3845  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • KRAS (T2-C185, G12V)
      Accession # AAH13572.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KRAS; Kras-Enoph1 Fusion Protein; Prev. KRAS2; PR310 C-K-Ras Oncogene; GTPase KRas; Small Monomeric GTPase; K-Ras4B; C-Kirsten-Ras Protein; KRAS1; Proto-Oncogene GTPase; V-Ki-Ras2 Kirsten Rat Sarcoma 2 Viral Oncogene Homolog; KRAS-ENOPH Fusion; Kirsten Ra

  • AA Sequence

    TEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

  • Predicted Molecular Mass

    23.6 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jianhua Ling, et al. KrasG12D-induced IKK2/β/NF-κB activation by IL-1α and p62 feedforward loops is required for development of pancreatic ductal adenocarcinoma. Cancer Cell. 2012 Jan 17;21(1):105-20. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Kras4B Protein, Human (184a.a, G12V, His) Product Image
    1/16
  • Kras4B Protein, Human (184a.a, G12V, His) Product Image