KRAS Protein, Human (G12V, His)

KRAS Protein, Human (G12V, His) is a 25-30 kDa human KRAS protein with G12V mutation and N-terminal His-tag. K-Ras belongs to the small GTPase superfamily, Ras family^[1].

Measured by its ability to catalyze the substrate GTP. The specific activity is 2.03 nmol/min/mg, as measured under the described conditions.

Human

E. coli

N-6*His

AAH13572.1 (T2-C185, G12V)

3845  [NCBI]

HHHHHHTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

25-30 kDa, observed by reducing SDS-PAGE

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Jianhua Ling, et al. KrasG12D-induced IKK2/β/NF-κB activation by IL-1α and p62 feedforward loops is required for development of pancreatic ductal adenocarcinoma. Cancer Cell. 2012 Jan 17;21(1):105-20.  [Content Brief]