LCN1/Lipocalin-1 Protein, Human (HEK293, His)

The LCN1/Lipocalin-1 protein may be involved in taste reception and contribute to the concentration and transport of taste molecules in the taste system. LCN1/Lipocalin-1 Protein, Human (HEK293, His) is the recombinant human-derived LCN1/Lipocalin-1 protein, expressed by HEK293 , with C-His labeled tag. The total length of LCN1/Lipocalin-1 Protein, Human (HEK293, His) is 158 a.a., with molecular weight of ~20 kDa.

LCN1 (Lipocalin-1) protein is implicated in taste reception and might play a crucial role in the concentration and delivery of sapid molecules within the gustatory system. Known for its broad ligand-binding capabilities, LCN1 interacts with various ligands, spanning lipids, retinoids, macrocyclic antibiotic rifampicin, and microbial siderophores, owing to its remarkably wide ligand pocket. The protein predominantly exists as a monomer but may also form homodimers. Additionally, LCN1 engages in an interaction with LMBR1L, facilitating the endocytosis of LCN1.

Human

HEK293

C-His

P31025 (H19-D176)

3933  [NCBI]

HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.