Legumain Protein, Mouse (HEK293, C-6His)

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions. Legumain Protein, Mouse (HEK293, C-6His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Legumain Protein, Mouse (HEK293, C-6His) is 418 a.a., with molecular weight of ~54.8 kDa.

Legumain protein exhibits a strict specificity for the hydrolysis of asparaginyl bonds. Additionally, it demonstrates the ability to cleave aspartyl bonds slowly, particularly in acidic conditions, further expanding its enzymatic versatility. Functionally, Legumain is integral to the processing of proteins for MHC class II antigen presentation within the lysosomal/endosomal system. It also plays a crucial role in MHC class I antigen presentation in cross-presenting dendritic cells by facilitating the cleavage and maturation of Perforin-2 (MPEG1), thereby promoting antigen translocation in the cytosol, as indicated by recent research findings. Moreover, Legumain is essential for normal lysosomal protein degradation in renal proximal tubules and is required for the degradation of internalized EGFR, highlighting its importance in cellular processes and the regulation of cell proliferation.

Mouse

HEK293

C-6*His

O89017 (V18-Y435)

19141  [NCBI]

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

Approximately 54.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.