1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Legumain Protein, Mouse (HEK293, C-His)

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions.Legumain Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg Get quote
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions.Legumain Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Legumain protein exhibits a strict specificity for the hydrolysis of asparaginyl bonds. Additionally, it demonstrates the ability to cleave aspartyl bonds slowly, particularly in acidic conditions, further expanding its enzymatic versatility. Functionally, Legumain is integral to the processing of proteins for MHC class II antigen presentation within the lysosomal/endosomal system. It also plays a crucial role in MHC class I antigen presentation in cross-presenting dendritic cells by facilitating the cleavage and maturation of Perforin-2 (MPEG1), thereby promoting antigen translocation in the cytosol, as indicated by recent research findings. Moreover, Legumain is essential for normal lysosomal protein degradation in renal proximal tubules and is required for the degradation of internalized EGFR, highlighting its importance in cellular processes and the regulation of cell proliferation.

Biological Activity

1. Measured in a cell proliferation assay using RAW264.7 cells. The ED50 this effect is 0.07438ng/mL, corresponding to a specific activity is 1.344×107 units/mg.
2. Measured by its ability to cleave the fluorogenic peptide substrate, N-carbobenzyloxy-Ala-Ala-Asn-7-amido-4-methylcoumarin (Z-AAN-AMC). The specific activity is >130 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated in acid buffer for an activated form.)

  • Measured in a cell proliferation assay using RAW264.7 cells.The ED50 for this effect is 0.07438 ng/mL, corresponding to a specific activity is 13444474.3211 units/mg.
Assay Procedure

Materials
Activation buffer: 0.1 M NaOAc, 0.1 M NaCl, pH 4.5
Assay buffer: 50 mM MES, 250 mM NaCl, pH 5.5
Legumain Protein, Mouse (HEK293, C-His) (HY-P70216A)
Substrate: Z-Ala-Ala-Asn-AMC (HY-136626), dissolved in DMSO to 10 mM
Standard: 7-Amino-4-methylcoumarin (AMC, HY-D0027)

Procedure
1. Preparation of Standard Curve: Dilute AMC with assay buffer to concentrations of 10000, 5000, 2500, 1250, 625, 312, 156, 78, 39, 19.5, and 0 pmol respectively. Add 100 μL of each dilution to the wells of a black microplate. Read in kinetic mode for 5 minutes using excitation and emission wavelengths of 380 nm and 460 nm (top read). Generate a standard curve with the measured RFU as the ordinate and the amount of standard substance as the abscissa, and derive the standard curve equation.
2. First, reconstitute the test protein with sterile water to 500 μg/mL, then dilute it to 50 μg/mL with activation buffer, and incubate at 37°C for 4 hours.
3. Dilute the protein solution to 2 ng/μL with assay buffer.
4. Dilute the substrate to 200 μM with assay buffer.
5. Initiate the reaction by adding 50 μL of 2 ng/μL Mouse Legumain and 50 μL of 200 μM substrate to each well. For blank wells, add 50 μL of assay buffer and 50 μL of 200 μM substrate.
6. Read in kinetic mode for 5 minutes using excitation and emission wavelengths of 380 nm and 460 nm.
7. Calculate the specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Per Well:
Mouse Legumain: 0.1 μg
Substrate: 100 μM

Species

Mouse

Source

HEK293

Tag

C-His

Accession

O89017 (V18-Y435)

Gene ID
Molecular Construction
N-term
Legumain (V18-Y435)
Accession # O89017
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuLegumain/Asparaginyl Endopeptidase, His; Legumain; Lgmn; Asparaginyl endopeptidase; Protease cysteine 1; Prsc1
AA Sequence

VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

Molecular Weight

Approximately 43-48 kDa & 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl/Tris, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Legumain Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Legumain Protein, Mouse (HEK293, C-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Legumain Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P70216A
Quantity:
MCE Japan Authorized Agent: