Legumain Protein, Mouse (HEK293, C-His)

Customer Review

Based on 1 Customer Validation

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions.Legumain Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Legumain proteins can slowly cleave aspartyl bonds, especially under acidic conditions.Legumain Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Legumain protein, expressed by HEK293 , with C-10*His labeled tag.

Background

Legumain protein exhibits a strict specificity for the hydrolysis of asparaginyl bonds. Additionally, it demonstrates the ability to cleave aspartyl bonds slowly, particularly in acidic conditions, further expanding its enzymatic versatility. Functionally, Legumain is integral to the processing of proteins for MHC class II antigen presentation within the lysosomal/endosomal system. It also plays a crucial role in MHC class I antigen presentation in cross-presenting dendritic cells by facilitating the cleavage and maturation of Perforin-2 (MPEG1), thereby promoting antigen translocation in the cytosol, as indicated by recent research findings. Moreover, Legumain is essential for normal lysosomal protein degradation in renal proximal tubules and is required for the degradation of internalized EGFR, highlighting its importance in cellular processes and the regulation of cell proliferation.

Verified Bioactivity

1. Measured in a cell proliferation assay using RAW264.7 cells. The ED50 this effect is 0.07438ng/mL, corresponding to a specific activity is 1.344×107 units/mg.
2. Measured by its ability to cleave the fluorogenic peptide substrate, N-carbobenzyloxy-Ala-Ala-Asn-7-amido-4-methylcoumarin (Z-AAN-AMC). The specific activity is >130 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated in acid buffer for an activated form.)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using RAW264.7 cells.The ED50 for this effect is 0.07438 ng/mL, corresponding to a specific activity is 13444474.3211 units/mg.

Assay Procedure

Materials
Activation buffer: 0.1 M NaOAc, 0.1 M NaCl, pH 4.5
Assay buffer: 50 mM MES, 250 mM NaCl, pH 5.5
Legumain Protein, Mouse (HEK293, C-His) (HY-P70216A)
Substrate: Z-Ala-Ala-Asn-AMC (HY-136626), dissolved in DMSO to 10 mM
Standard: 7-Amino-4-methylcoumarin (AMC, HY-D0027)

Procedure
1. Preparation of Standard Curve: Dilute AMC with assay buffer to concentrations of 10000, 5000, 2500, 1250, 625, 312, 156, 78, 39, 19.5, and 0 pmol respectively. Add 100 μL of each dilution to the wells of a black microplate. Read in kinetic mode for 5 minutes using excitation and emission wavelengths of 380 nm and 460 nm (top read). Generate a standard curve with the measured RFU as the ordinate and the amount of standard substance as the abscissa, and derive the standard curve equation.
2. First, reconstitute the test protein with sterile water to 500 μg/mL, then dilute it to 50 μg/mL with activation buffer, and incubate at 37°C for 4 hours.
3. Dilute the protein solution to 2 ng/μL with assay buffer.
4. Dilute the substrate to 200 μM with assay buffer.
5. Initiate the reaction by adding 50 μL of 2 ng/μL Mouse Legumain and 50 μL of 200 μM substrate to each well. For blank wells, add 50 μL of assay buffer and 50 μL of 200 μM substrate.
6. Read in kinetic mode for 5 minutes using excitation and emission wavelengths of 380 nm and 460 nm.
7. Calculate the specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Per Well:
Mouse Legumain: 0.1 μg
Substrate: 100 μM

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Legumain (V18-Y435)
      Accession # O89017
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LGMN; LGMN1; Prev. PRSC1; AEP; Asparaginyl Endopeptidase; Cysteine Protease 1; Protease, Cysteine 1; Legumain; Protease, Cysteine, 1 (Legumain)

  • AA Sequence

    VPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLSHY

  • Molecular Weight

    Approximately 43-48 kDa & 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl/Tris, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00