LSAMP Protein, Human (HEK293, His)
Based on 1 Customer Validation
LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LSAMP Protein serves as a crucial mediator in orchestrating selective neuronal growth and precise axon targeting, playing a pivotal role in guiding developing axons and facilitating the remodeling of mature circuits within the limbic system. The protein's significance extends to its essential role in ensuring the normal growth of the hippocampal mossy fiber projection, thereby contributing to the intricate architecture of neural pathways. Through its involvement in these processes, LSAMP emerges as a key player in the intricate orchestration of neural development, impacting both the establishment of neuronal connections during development and the adaptive changes within mature circuits in the limbic system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q13449 (V29-N315)
-
Molecular Construction
-
N-term
-
LSAMP (V29-N315)
Accession # Q13449 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LSAMP; LAMP; Limbic System Associated Membrane Protein; Limbic System-Associated Membrane Protein; IGLON3; IgLON Family Member 3
-
AA Sequence
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
-
Predicted Molecular Mass
32.8 kDa
-
Molecular Weight
Approximately 45-65 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
