LSAMP Protein, Human (HEK293, His)

LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LSAMP Protein, Human (HEK293, His) is 287 a.a., with molecular weight of 45-65 kDa.

LSAMP Protein serves as a crucial mediator in orchestrating selective neuronal growth and precise axon targeting, playing a pivotal role in guiding developing axons and facilitating the remodeling of mature circuits within the limbic system. The protein's significance extends to its essential role in ensuring the normal growth of the hippocampal mossy fiber projection, thereby contributing to the intricate architecture of neural pathways. Through its involvement in these processes, LSAMP emerges as a key player in the intricate orchestration of neural development, impacting both the establishment of neuronal connections during development and the adaptive changes within mature circuits in the limbic system.

Human

HEK293

C-6*His

Q13449 (V29-N315)

4045  [NCBI]

VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN

45-65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.