LSAMP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LSAMP proteins are key mediators that orchestrate selective neuronal growth and precise axonal targeting, playing a critical role in guiding axonal development and promoting mature circuit remodeling within the limbic system. Its importance extends to ensuring the normal growth of hippocampal mossy fiber projections, which contribute to the formation of complex neural pathway structures. LSAMP Protein, Human (HEK293, His) is the recombinant human-derived LSAMP protein, expressed by HEK293 , with C-6*His labeled tag.

Background

LSAMP Protein serves as a crucial mediator in orchestrating selective neuronal growth and precise axon targeting, playing a pivotal role in guiding developing axons and facilitating the remodeling of mature circuits within the limbic system. The protein's significance extends to its essential role in ensuring the normal growth of the hippocampal mossy fiber projection, thereby contributing to the intricate architecture of neural pathways. Through its involvement in these processes, LSAMP emerges as a key player in the intricate orchestration of neural development, impacting both the establishment of neuronal connections during development and the adaptive changes within mature circuits in the limbic system.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LSAMP (V29-N315)
      Accession # Q13449
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LSAMP; LAMP; Limbic System Associated Membrane Protein; Limbic System-Associated Membrane Protein; IGLON3; IgLON Family Member 3

  • AA Sequence

    VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN

  • Predicted Molecular Mass

    32.8 kDa

  • Molecular Weight

    Approximately 45-65 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00