1. Recombinant Proteins
  2. Others
  3. LSM1 Protein, Human (His)

LSM1 Protein, Human (His)

Cat. No.: HY-P70198
Handling Instructions

LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation. Likely part of an LSm subunit-containing complex involved in general mRNA degradation. It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase. The LSm subunits collectively form a donut-shaped heteromer. LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of LSM1 Protein, Human (His) is 133 a.a., with molecular weight of ~19.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation. Likely part of an LSm subunit-containing complex involved in general mRNA degradation. It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase. The LSm subunits collectively form a donut-shaped heteromer. LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of LSM1 Protein, Human (His) is 133 a.a., with molecular weight of ~19.0 kDa.

Background

LSM1 (Like-Sm Protein 1) takes center stage in the intricate process of histone mRNA degradation, a unique task among eukaryotic mRNAs due to their lack of polyadenylation. This essential protein is likely a crucial component of an LSm subunit-containing complex involved in the broader mechanism of mRNA degradation, contributing to the maintenance of cellular homeostasis. In particular, LSM1 forms a significant interaction with SLBP, emphasizing its role during the S phase when histone mRNA undergoes rapid degradation. The LSm subunits, when assembled, create a heteromer with a distinctive donut shape, further highlighting the structural complexity associated with their functional involvement in mRNA degradation pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O15116 (M1-Y133)

Gene ID
Molecular Construction
N-term
LSM1 (M1-Y133)
Accession # O15116
6*His
C-term
Synonyms
rHuU6 snRNA-associated Sm-like protein LSm1, His; U6 snRNA-Associated Sm-Like Protein LSm1; Cancer-Associated Sm-Like; Small Nuclear Ribonuclear CaSm; LSM1; CASM
AA Sequence

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

Molecular Weight

Approximately 19.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LSM1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSM1 Protein, Human (His)
Cat. No.:
HY-P70198
Quantity:
MCE Japan Authorized Agent: