LSM1 Protein, Human (His)
LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LSM1 protein participates in the degradation of histone mRNAs, unique among eukaryotic mRNAs for lacking polyadenylation.Likely part of an LSm subunit-containing complex involved in general mRNA degradation.It interacts with SLBP, particularly during rapid histone mRNA degradation in the S phase.The LSm subunits collectively form a donut-shaped heteromer.LSM1 Protein, Human (His) is the recombinant human-derived LSM1 protein, expressed by E.coli , with C-6*His labeled tag.
Background
LSM1 (Like-Sm Protein 1) takes center stage in the intricate process of histone mRNA degradation, a unique task among eukaryotic mRNAs due to their lack of polyadenylation. This essential protein is likely a crucial component of an LSm subunit-containing complex involved in the broader mechanism of mRNA degradation, contributing to the maintenance of cellular homeostasis. In particular, LSM1 forms a significant interaction with SLBP, emphasizing its role during the S phase when histone mRNA undergoes rapid degradation. The LSm subunits, when assembled, create a heteromer with a distinctive donut shape, further highlighting the structural complexity associated with their functional involvement in mRNA degradation pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O15116 (M1-Y133)
-
Molecular Construction
-
N-term
-
LSM1 (M1-Y133)
Accession # O15116 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LSM1; LSM1 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae); LSM1 Homolog, MRNA Degradation Associated; LSM1-Like Protein U6 Small Nuclear RNA Associated Isoform 3; CASM; LSM1-Like Protein U6 Small Nuclear RNA Associated; U6 SnRNA-Associated Sm-Li
-
AA Sequence
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
-
Predicted Molecular Mass
16.2 kDa
-
Molecular Weight
Approximately 20-24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
