Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO)
Based on 1 Customer Validation
Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, serves as a key regulator of T-lymphocyte proliferation, differentiation, and activation. Functionally, it modulates T-cell receptor (TCR) signaling by interacting with the CD3Z/CD247 component at the plasma membrane, thereby influencing the phosphorylation status of CD3Z/CD247. Additionally, LY6E plays a critical role in restricting the entry of human coronaviruses, including SARS-CoV, MERS-CoV, and SARS-CoV-2, by disrupting spike protein-mediated membrane fusion. Notably, it acts as the primary receptor for syncytin-A (SynA), contributing to placenta formation by facilitating the fusion of syncytiotrophoblast layer I (SynT-I) and ensuring proper morphogenesis of fetal and maternal vasculatures within the placenta. Furthermore, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In the context of microbial infection, LY6E both facilitates and restricts viral entry, enhancing the fusion process for various viruses, including HIV-1, West Nile virus, dengue virus, and Zika virus, while being dispensable for the paramyxovirus PIV5 that enters at the plasma membrane. Mechanistically, LY6E adopts a microtubule-like organization upon viral infection, contributing to enhanced viral uncoating following endosomal escape.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q16553 (L21-S101)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
LY6E (L21-S101)
Accession # Q16553 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LY6E; Thymic Shared Antigen 1; Lymphocyte Antigen 6 Family Member E; Lymphocyte Antigen 6E; TSA-1; Stem Cell Antigen 2; RIG-E; Ly-6E; SCA-2; RIGE; Lymphocyte Antigen 6 Complex, Locus E; SCA2; Retinoic Acid-Induced Gene E Protein; TSA1; Retinoic Acid Induc
-
AA Sequence
LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
-
Predicted Molecular Mass
24.5 kDa
-
Molecular Weight
Approximately 25-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)