Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, serves as a key regulator of T-lymphocyte proliferation, differentiation, and activation. Functionally, it modulates T-cell receptor (TCR) signaling by interacting with the CD3Z/CD247 component at the plasma membrane, thereby influencing the phosphorylation status of CD3Z/CD247. Additionally, LY6E plays a critical role in restricting the entry of human coronaviruses, including SARS-CoV, MERS-CoV, and SARS-CoV-2, by disrupting spike protein-mediated membrane fusion. Notably, it acts as the primary receptor for syncytin-A (SynA), contributing to placenta formation by facilitating the fusion of syncytiotrophoblast layer I (SynT-I) and ensuring proper morphogenesis of fetal and maternal vasculatures within the placenta. Furthermore, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In the context of microbial infection, LY6E both facilitates and restricts viral entry, enhancing the fusion process for various viruses, including HIV-1, West Nile virus, dengue virus, and Zika virus, while being dispensable for the paramyxovirus PIV5 that enters at the plasma membrane. Mechanistically, LY6E adopts a microtubule-like organization upon viral infection, contributing to enhanced viral uncoating following endosomal escape.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • LY6E (L21-S101)
      Accession # Q16553
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    LY6E; Thymic Shared Antigen 1; Lymphocyte Antigen 6 Family Member E; Lymphocyte Antigen 6E; TSA-1; Stem Cell Antigen 2; RIG-E; Ly-6E; SCA-2; RIGE; Lymphocyte Antigen 6 Complex, Locus E; SCA2; Retinoic Acid-Induced Gene E Protein; TSA1; Retinoic Acid Induc

  • AA Sequence

    LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

  • Predicted Molecular Mass

    24.5 kDa

  • Molecular Weight

    Approximately 25-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00