LYG2 Protein, Human (HEK293, His)

LYG2 Protein emerges as a potent antibacterial agent, indicating a pivotal role in innate immunity. Its putative capacity as an antibacterial protein suggests active participation in the host's defense against bacterial threats. LYG2's role underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections. LYG2 Protein, Human (HEK293, His) is the recombinant human-derived LYG2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LYG2 Protein, Human (HEK293, His) is 193 a.a., with molecular weight of 23-27 kDa.

The LYG2 protein emerges as a potent antibacterial entity, suggesting a potential pivotal role in innate immunity. With its putative capacity as an antibacterial protein, LYG2 implies active participation in the host's defense mechanisms against bacterial threats. The protein's role in innate immunity underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections.

Human

HEK293

C-6*His

Q86SG7 (S20-F212)

254773  [NCBI]

SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF

23-27 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.