LYG2 Protein, Human (HEK293, His)
LYG2 Protein emerges as a potent antibacterial agent, indicating a pivotal role in innate immunity. Its putative capacity as an antibacterial protein suggests active participation in the host's defense against bacterial threats. LYG2's role underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections. LYG2 Protein, Human (HEK293, His) is the recombinant human-derived LYG2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LYG2 Protein emerges as a potent antibacterial agent, indicating a pivotal role in innate immunity. Its putative capacity as an antibacterial protein suggests active participation in the host's defense against bacterial threats. LYG2's role underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections. LYG2 Protein, Human (HEK293, His) is the recombinant human-derived LYG2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The LYG2 protein emerges as a potent antibacterial entity, suggesting a potential pivotal role in innate immunity. With its putative capacity as an antibacterial protein, LYG2 implies active participation in the host's defense mechanisms against bacterial threats. The protein's role in innate immunity underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q86SG7-1 (S20-F212)
-
Molecular Construction
-
N-term
-
LYG2 (S20-F212)
Accession # Q86SG7-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LYG2; Lysozyme G-Like Protein 2; Lysozyme G2; Lysozyme G-Like 2; LYGH; Lysozyme-Like, Isoform CRA_a; LYGA2; LYSG2
-
AA Sequence
SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF
-
Predicted Molecular Mass
22.6 kDa
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
