Copy Link Print Information

M-CSF Protein, Rat (CHO)

11 Cited Publications
Customer Review

Based on 11 publication(s) in Google Scholar

M-CSF Protein, Rat (CHO) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • M-CSF Protein, Rat (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

M-CSF Protein, Rat (CHO) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

Background

Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

Verified Bioactivity

Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 0.5-2.5 ng/mL.

Technical Parameters

  • Species Rat
  • Source CHO
  • Tag Tag Free
  • Accession

    Q8JZQ0-1 (E33-P186)

  • Gene ID
    78965  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (E33-P186)
      Accession # Q8JZQ0-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo

  • AA Sequence

    EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP

  • Predicted Molecular Mass

    18 kDa

  • Molecular Weight

    Approximately 32-40 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Glycosylation

    Yes

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8(7):533-44. [Content Brief]

[2]. Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58(8):2257-67. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using M-NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED50 for this effect is 1.548 ng/mL, corresponding to a specific activity is 6.459×105 units/mg.

  • 1/16

    M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 Oct 17:35:102423. [Abstract]

    Customer Validation
     M-CSF Protein, Rat (CHO) (30 ng/mL; 7 d). Flow cytometry analysis confirmed over 90% of the differentiated cells were double-positive for CD11b and CD68, confirming the successful isolation and differentiation of BMDMs.

  • 1/16

    M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Cell Biosci. 2023 Feb 4;13(1):23. [Abstract]

    Customer Validation
     M-CSF Protein, Rat (CHO) (20 ng/mL; 37 ℃; 7 d). F4/80 and CD11b were used as specific markers of macrophages, and immunofluorescence staining was applied to identify the extracted primary macrophages from the femur and tibia of Wistar rats.

  • 1/16

    M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Immunol Lett. 2023 Jul:259:1-8. [Abstract]

    Customer Validation
     M-CSF Protein, Rat (CHO) (20 ng/mL; 7 d). The results of immunofluorescence staining revealed that the induced M0 macrophages had high expression of CD11b and low expression of CD206, while M2 macrophages had high expression of CD11b and CD206, which was fully consistent with the known immunophenotypic profile of M0/M2 macrophages.

  • M-CSF Protein, Rat (CHO) Product Image
    1/16
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • Experimental Validation Results for M-CSF Protein, Rat (CHO)
  • M-CSF Protein, Rat (CHO) Product Image

  • M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Mater Today Bio. 2025 Oct 17:35:102423. [Abstract]

    M-CSF Protein, Rat (CHO) (30 ng/mL; 7 d). Flow cytometry analysis confirmed over 90% of the differentiated cells were double-positive for CD11b and CD68, confirming the successful isolation and differentiation of BMDMs.

  • M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Cell Biosci. 2023 Feb 4;13(1):23. [Abstract]

    M-CSF Protein, Rat (CHO) (20 ng/mL; 37 ℃; 7 d). F4/80 and CD11b were used as specific markers of macrophages, and immunofluorescence staining was applied to identify the extracted primary macrophages from the femur and tibia of Wistar rats.

  • M-CSF Protein, Rat (CHO) purchased from MedChemExpress. Usage Cited in: Immunol Lett. 2023 Jul:259:1-8. [Abstract]

    M-CSF Protein, Rat (CHO) (20 ng/mL; 7 d). The results of immunofluorescence staining revealed that the induced M0 macrophages had high expression of CD11b and low expression of CD206, while M2 macrophages had high expression of CD11b and CD206, which was fully consistent with the known immunophenotypic profile of M0/M2 macrophages.