1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Rat (CHO)

M-CSF Protein, Rat (CHO)

Cat. No.: HY-P7247
COA Handling Instructions

M-CSF Protein, Rat (CHO) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $190 In-stock
50 μg $590 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

M-CSF Protein, Rat (CHO) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.

Background

Macrophage Colony Stimulating Factor (M-CSF) is a pro-inflammatory cytokine, constitutively produced by several cell types, such as fibroblasts, endothelial cells, stromal cells, macrophages, smooth muscle cells and osteoblasts, binds to its receptor CSF1R, and exists in several isoforms- as a secreted glycoprotein, a cell-surface protein and a proteoglycan[1]. M-CSF is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts, which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes seen in patients with rheumatoid arthritis[2].

Biological Activity

The ED50 is <2.5 ng/mL as measured by murine M-NFS-60 cells, corresponding to a specific activity of >4.0 × 105 units/mg.

Species

Rat

Source

CHO

Tag

Tag Free

Accession

Q8JZQ0 (E33-P186)

Gene ID

78965  [NCBI]

Molecular Construction
N-term
M-CSF (E33-P186)
Accession # Q8JZQ0
C-term
Synonyms
rRtM-CSF; CSF1; MCSF
AA Sequence

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKP

Molecular Weight

32-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

M-CSF Protein, Rat (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M-CSF Protein, Rat (CHO)
Cat. No.:
HY-P7247
Quantity:
MCE Japan Authorized Agent: