MDM4/MDMX Protein, Human (His)
Based on 1 Customer Validation
MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MDM4/MDMX proteins cooperate with MDM2 to regulate TP53 (p53) and inhibit the transcriptional activation domains of p53 and p73. This hinders their ability to induce cell cycle arrest and apoptosis. MDM4/MDMX Protein, Human (His) is the recombinant human-derived MDM4/MDMX protein, expressed by E. coli , with N-His labeled tag.
Background
MDM4/MDMX Protein collaborates with MDM2 in regulating TP53 (p53). It functions by inhibiting the transcriptional activation domain of p53 and p73, thereby impeding their ability to induce cell cycle arrest and apoptosis. Moreover, MDM4 hinders the degradation of MDM2 and can reverse MDM2-mediated degradation of TP53 while concurrently suppressing TP53 transactivation and apoptotic functions. The protein forms a trimeric complex with MDM2 and USP2 and interacts with TP53, TP73, and USP2. Notably, when phosphorylated, MDM4 interacts with YWHAG, exerting a negative regulatory effect on its activity towards TP53. These interactions highlight the intricate role of MDM4 in modulating key components of the TP53 pathway, contributing to the finely tuned regulation of cellular responses to stress and DNA damage.
Verified Bioactivity
Measured by its ability to promote proliferation of A549 human non small cell lung cancer cell. The ED50 for this effect is 33.7 ng/mL, corresponding to a specific activity is 2.967×104 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
O15151-1/NP_002384.2 (M1-D134)
-
Molecular Construction
-
N-term
-
His
-
MDM4 (M1-D134)
Accession # O15151/NP_002384.2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MDM4; Mdm4 P53 Binding Protein Homolog (Mouse); MDM4 Regulator Of P53; Uncharacterized Protein DKFZp686B01123; MDMX; Uncharacterized Protein DKFZp781B1423; HDMX; Mdm4 P53 Binding Protein Homolog; Mdm2-Like P53-Binding Protein; P53-Binding Protein Mdm4; MD
-
AA Sequence
MTSFSTSAQCSTSDSACRISPGQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQD
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.8.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
