Niemann Pick C2/NPC2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The Niemann Pick C2/NPC2 Protein is a crucial lysosomal protein that regulates cholesterol trafficking and lipid metabolism. It enables the movement of cholesterol from lysosomes to other parts of the cell. Studying the functions of NPC2 Protein is essential for understanding lipid disorders and developing treatments targeting disrupted cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Human (HEK293, His) is the recombinant human-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Niemann Pick C2/NPC2 Protein is a crucial lysosomal protein that regulates cholesterol trafficking and lipid metabolism. It enables the movement of cholesterol from lysosomes to other parts of the cell. Studying the functions of NPC2 Protein is essential for understanding lipid disorders and developing treatments targeting disrupted cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Human (HEK293, His) is the recombinant human-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Niemann Pick C2 (NPC2) functions as a crucial intracellular cholesterol transporter, collaborating synergistically with NPC1 in facilitating the efflux of cholesterol from the lysosomal compartment. Upon the release of unesterified cholesterol from LDLs within the lumen of late endosomes/lysosomes, NPC2 plays a pivotal role by transferring cholesterol to the cholesterol-binding pocket located in the N-terminal domain of NPC1. Notably, NPC2 exhibits a 1:1 stoichiometry in binding cholesterol and demonstrates the capacity to bind various sterols, including lathosterol, desmosterol, and plant sterols like stigmasterol and beta-sitosterol. Moreover, NPC2 may bind and mobilize cholesterol associated with membranes. The secreted form of NPC2 further contributes to the regulation of biliary cholesterol secretion by stimulating ABCG5/ABCG8-mediated cholesterol transport.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P61916-1 (E20-L151)
-
Molecular Construction
-
N-term
-
NPC2 (E20-L151)
Accession # P61916-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NPC2; Epididymal Protein 1; NPC Intracellular Cholesterol Transporter 2; NP-C2; HE1; Epididymis Secretory Sperm Binding Protein; EDDM1; Tissue-Specific Secretory Protein; Niemann-Pick Disease Type C2 Protein; Niemann-Pick Disease, Type C2; Human Epididymi
-
AA Sequence
EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL
-
Predicted Molecular Mass
15.7 kDa
-
Molecular Weight
Approximately 21-24 kDa & 24-35 kDa kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
