Niemann Pick C2/NPC2 Protein, Human (HEK293, His)

The Niemann Pick C2/NPC2 Protein is a crucial lysosomal protein that regulates cholesterol trafficking and lipid metabolism. It enables the movement of cholesterol from lysosomes to other parts of the cell. Studying the functions of NPC2 Protein is essential for understanding lipid disorders and developing treatments targeting disrupted cholesterol metabolism. Niemann Pick C2/NPC2 Protein, Human (HEK293, His) is the recombinant human-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag. The total length of Niemann Pick C2/NPC2 Protein, Human (HEK293, His) is 132 a.a., with molecular weight of 21-24 kDa & 27-35 kDa, respectively.

Niemann Pick C2 (NPC2) functions as a crucial intracellular cholesterol transporter, collaborating synergistically with NPC1 in facilitating the efflux of cholesterol from the lysosomal compartment. Upon the release of unesterified cholesterol from LDLs within the lumen of late endosomes/lysosomes, NPC2 plays a pivotal role by transferring cholesterol to the cholesterol-binding pocket located in the N-terminal domain of NPC1. Notably, NPC2 exhibits a 1:1 stoichiometry in binding cholesterol and demonstrates the capacity to bind various sterols, including lathosterol, desmosterol, and plant sterols like stigmasterol and beta-sitosterol. Moreover, NPC2 may bind and mobilize cholesterol associated with membranes. The secreted form of NPC2 further contributes to the regulation of biliary cholesterol secretion by stimulating ABCG5/ABCG8-mediated cholesterol transport.

Human

HEK293

C-His

P61916 (E20-L151)

10577  [NCBI]

EPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL

21-24 kDa & 27-35 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.