NNT1/CLC Protein, Human (HEK293, Fc)

NNT1/CLC protein binds to CRLF1 to form an important neurotropic cytokine related to neuronal development. In addition, it stimulates B cells and upon binding activates the ILST/gp130 receptor. NNT1/CLC Protein, Human (HEK293, Fc) is the recombinant human-derived NNT1/CLC protein, expressed by HEK293 , with N-hFc labeled tag. The total length of NNT1/CLC Protein, Human (HEK293, Fc) is 198 a.a., with molecular weight of ~53 kDa.

In conjunction with CRLF1, the NNT1/CLC protein forms a heterodimeric neurotropic cytokine, likely playing a crucial role in neuronal development. Additionally, NNT1/CLC stimulates B-cells and binds to, activating the ILST/gp130 receptor. It forms a heteromeric complex with the cardiotrophin-like cytokine CRLF1/CLF-1, and this CRLF1-CLCF1 complex serves as a ligand for the ciliary neurotrophic factor receptor/CNTFR. Notably, both the CRLF1-CLCF1 heterodimer and the tripartite signaling complex, composed of CRLF1, CLCF1, and CNTFR, bind to SORL1, with the interaction predominantly mediated by the CRLF1 moiety within the complex. These intricate associations underscore the diverse functions of NNT1/CLC protein in neurodevelopmental processes and immune regulation.

Human

HEK293

N-hFc

Q9UBD9/ NP_037378.1 (L28-F225)

23529  [NCBI]

LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Approximately 53 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.